Protein Family IF04532

Metagenome Isolate
125 Members
45 Samples
124 Scaffolds
500.54 Avg Length

🧬 Representative Sequence

ID
3300042590|Ga0466690_213508|Ga0466690_213508_390_2099
Length
544 aa
Sequence
MAYIRYVNNPSGAVYASLVDGERVGKSVKQKYLGSLGLVIDRENGIFKNYQYSIESGYSEIPSGSEHAGVGRPRKEKLILDFGDSFVLDKYLSTLPFYSAYQIVMPLHKDTLFSLLFYRILTDKKAYCYADSWWSGNYACILFPGAKLQSQRVSEFLVMLGDEEVQRKFFDEYLTTIYGKQGGTSGILIDSTGLTNMSKMSLTQLSHHNGEISMEIRLIYVIDRRNGMPIYFRYCPGNIVDVSTLCITLAELSQFNIAIDYAIVDAGYFSEGNVKELYKNNVHFVTRLAPNRTIYKQVTESELTDILSSKYAVRYGNRLVYLKKKEIDIYGYTGYAYIGVDMDSRNQQFKRTAFAAIEDKKSLEEMDERIAKLGVFILLSSDDMETSEILPLYYTRQQIEQIFDIGKNYADLLPLRVQSEDTFRGHLMLTFMATAILQMLQRDILSKRKKKDKTNPEGAFMYLRNQKCKVYGKNIIPQERVKNVNEIYKLLGIVCPTTIDSTNSPSSSRKWCGRQRKKQRRRDAVVFCGLYERQSGNYYRIHRP

📊 Sample Types

Isolate 0.8%
Metagenome 99.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 53.5%
Kalotermitidae 30.2%
Unclassified 7.0%
Passalidae 4.7%
Termopsidae 4.7%

🌳 Taxonomy

Archaea 0
Bacteria 95
Eukaryota 0
Viruses 0
Unclassified 30

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820220859 Unclassified Firmicutes Th196P4bin59 Isolate Unclassified
2 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
3 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
4 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
5 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
6 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
7 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
8 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
9 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
10 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
11 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
12 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
13 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
14 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
15 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
16 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
17 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
18 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
19 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
20 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
21 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
22 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
23 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
24 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
25 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
26 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
27 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
28 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
29 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
30 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
31 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
32 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
33 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
34 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
35 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
36 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
37 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
38 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
39 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
40 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
41 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
42 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
43 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
44 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
45 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466697_169390 3300042611 Bacteria 2817
2 Ga0466705_531539 3300042612 Bacteria 2348
3 Ga0466715_283457 3300042616 Bacteria 2255
4 Ga0466728_399182 3300042620 Bacteria 2150
5 Ga0466703_102686 3300042636 Unclassified 1947
6 Ga0466727_302259 3300042655 Unclassified 1964
7 Ga0466690_213508 3300042590 Bacteria 2785
8 Ga0466690_337239 3300042590 Unclassified 3912
9 Ga0466700_218468 3300042600 Bacteria 1895
10 Ga0466717_185389 3300042604 Bacteria 2164
11 Ga0466697_004161 3300042611 Bacteria 2593
12 Ga0466697_037267 3300042611 Unclassified 3326
13 JGI24695J34938_10050882 3300002450 Bacteria 1815
14 Ga0466697_225584 3300042611 Bacteria 2243
15 Ga0466711_002399 3300042615 Bacteria 5674
16 Ga0466715_376582 3300042616 Bacteria 3544
17 Ga0466726_343518 3300042619 Unclassified 1593
18 Ga0466703_364213 3300042636 Bacteria 2339
19 Ga0466696_370712 3300042596 Bacteria 2315
20 Ga0466721_152729 3300042608 Unclassified 1804
21 2227626294 2225789004 Bacteria 2153
22 IMNBL1DRAFT_c0026936 3300000062 Bacteria 2174
23 JGI24702J35022_10009624 3300002462 Bacteria 5419
24 Ga0123356_10374114 3300010049 Bacteria 1555
25 Ga0466715_046271 3300042616 Bacteria 2060
26 Ga0466718_019174 3300042617 Bacteria 1824
27 Ga0466723_240639 3300042618 Bacteria 2375
28 Ga0466723_297470 3300042618 Unclassified 2380
29 Ga0466728_107250 3300042620 Bacteria 3158
30 Ga0466731_291019 3300042622 Bacteria 3820
31 Ga0466703_052185 3300042636 Bacteria 3418
32 Ga0466693_256019 3300042592 Bacteria 1878
33 Ga0466694_285032 3300042594 Bacteria 2177
34 Ga0466699_030879 3300042597 Bacteria 1957
35 Ga0466700_032555 3300042600 Unclassified 2204
36 Ga0466700_126277 3300042600 Unclassified 2353
37 Ga0466717_038525 3300042604 Unclassified 1986
38 Ga0466717_052975 3300042604 Bacteria 3218
39 Ga0466716_363762 3300042605 Unclassified 2648
40 Ga0466705_218567 3300042612 Bacteria 2677
41 Ga0123356_10085274 3300010049 Bacteria 2995
42 Ga0123356_10144267 3300010049 Bacteria 2353
43 Ga0466711_216845 3300042615 Bacteria 11004
44 Ga0466723_012182 3300042618 Bacteria 1699
45 Ga0466723_259195 3300042618 Bacteria 3762
46 Ga0466704_225187 3300042643 Bacteria 3917
47 Ga0264413_131440 3300024493 Unclassified 1944
48 Ga0466690_161968 3300042590 Unclassified 2163
49 Ga0466691_099858 3300042593 Bacteria 2243
50 Ga0466694_050881 3300042594 Bacteria 1895
51 Ga0466694_279765 3300042594 Bacteria 2795
52 Ga0466694_374017 3300042594 Bacteria 2678
53 Ga0466696_320534 3300042596 Bacteria 5197
54 Ga0466696_330743 3300042596 Bacteria 2597
55 Ga0466700_182489 3300042600 Bacteria 2171
56 Ga0466707_421183 3300042601 Bacteria 3656
57 Ga0466717_038805 3300042604 Bacteria 1817
58 Ga0466719_064099 3300042606 Bacteria 4134
59 Ga0466720_193364 3300042607 Bacteria 2384
60 Ga0466721_393376 3300042608 Bacteria 2569
61 JGI24702J35022_10077514 3300002462 Unclassified 1798
62 JGI24705J35276_12223734 3300002504 Bacteria 2539
63 Ga0068305_10083773 3300005083 Unclassified 1662
64 Ga0123353_10333701 3300010167 Bacteria 2294
65 Ga0466711_502946 3300042615 Bacteria 2455
66 Ga0466715_041891 3300042616 Bacteria 4117
67 Ga0466718_073995 3300042617 Unclassified 2034
68 Ga0466728_280473 3300042620 Bacteria 5478
69 Ga0415639_156688 3300038395 Bacteria 3948
70 Ga0466700_192393 3300042600 Bacteria 2670
71 Ga0466717_115102 3300042604 Unclassified 1538
72 Ga0466697_054190 3300042611 Unclassified 1944
73 Ga0466733_011784 3300042659 Bacteria 3133
74 Ga0123356_10214524 3300010049 Unclassified 1976
75 Ga0123356_10214994 3300010049 Bacteria 1975
76 Ga0123356_10228167 3300010049 Unclassified 1924
77 Ga0123353_10078884 3300010167 Bacteria 5293
78 Ga0466705_485491 3300042612 Bacteria 1838
79 Ga0466711_178734 3300042615 Bacteria 5084
80 Ga0466715_315439 3300042616 Bacteria 2713
81 Ga0466731_275374 3300042622 Unclassified 1880
82 Ga0466731_380256 3300042622 Bacteria 1455
83 Ga0466703_433033 3300042636 Bacteria 2215
84 Ga0466708_287478 3300042652 Bacteria 1902
85 Ga0415639_053462 3300038395 Unclassified 2196
86 Ga0466657_028602 3300042582 Bacteria 3624
87 Ga0466693_039697 3300042592 Bacteria 3339
88 Ga0466693_356477 3300042592 Bacteria 1984
89 Ga0466691_032899 3300042593 Bacteria 2209
90 Ga0466696_479103 3300042596 Bacteria 3266
91 Ga0466700_237127 3300042600 Bacteria 1921
92 Ga0466716_200709 3300042605 Bacteria 2178
93 Ga0072941_1056103 3300005201 Bacteria 8846
94 Ga0072941_1188479 3300005201 Bacteria 2110
95 Ga0466697_180988 3300042611 Bacteria 1813
96 Ga0466705_149674 3300042612 Bacteria 73922
97 Ga0466733_187567 3300042659 Unclassified 1881
98 Ga0123357_10194189 3300009784 Unclassified 2330
99 Ga0123356_10014436 3300010049 Bacteria 7595
100 Ga0466710_090096 3300042613 Bacteria 1741
101 Ga0466723_227439 3300042618 Bacteria 2142
102 Ga0466723_343127 3300042618 Bacteria 2753
103 Ga0466731_192539 3300042622 Bacteria 1638
104 Ga0466703_130569 3300042636 Bacteria 2383
105 Ga0466708_072517 3300042652 Bacteria 3026
106 Ga0466727_192731 3300042655 Bacteria 2971
107 Ga0466691_135881 3300042593 Bacteria 2662
108 Ga0466695_313675 3300042595 Bacteria 1872
109 Ga0466699_094360 3300042597 Unclassified 1854
110 Ga0466701_080036 3300042598 Unclassified 1952
111 Ga0466707_054930 3300042601 Bacteria 3295
112 Ga0466716_370411 3300042605 Unclassified 1859
113 Ga0466719_209934 3300042606 Bacteria 2202
114 Ga0466719_267005 3300042606 Bacteria 3495
115 Ga0466698_227828 3300042610 Unclassified 1810
116 Ga0466705_021961 3300042612 Bacteria 8077
117 Ga0123353_10391733 3300010167 Bacteria 2072
118 Ga0123353_10485359 3300010167 Unclassified 1806
119 Ga0466723_080080 3300042618 Unclassified 3008
120 Ga0466690_080376 3300042590 Bacteria 2168
121 Ga0466690_391102 3300042590 Bacteria 2781
122 Ga0466693_110322 3300042592 Bacteria 3056
123 Ga0466693_340200 3300042592 Bacteria 3172
124 Ga0466716_235156 3300042605 Bacteria 1987

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042590 Ga0466690_080376 Ga0466690_080376_134_1390 418
2 3300042597 Ga0466699_094360 Ga0466699_094360_95_1393 432
3 3300042616 Ga0466715_041891 Ga0466715_041891_2563_3861 432
4 3300042616 Ga0466715_315439 Ga0466715_315439_1139_2437 432
5 3300042592 Ga0466693_340200 Ga0466693_340200_344_1669 441
6 3300042622 Ga0466731_380256 Ga0466731_380256_85_1410 441
7 3300042593 Ga0466691_099858 Ga0466691_099858_845_2206 453
8 3300042619 Ga0466726_343518 Ga0466726_343518_11_1384 457
9 3300042613 Ga0466710_090096 Ga0466710_090096_305_1684 459
10 3300010049 Ga0123356_10374114 Ga0123356_103741141 468
11 3300042596 Ga0466696_370712 Ga0466696_370712_251_1660 469
12 3300042592 Ga0466693_356477 Ga0466693_356477_259_1797 477
13 3300042615 Ga0466711_216845 Ga0466711_216845_9164_10627 480
14 3300042618 Ga0466723_012182 Ga0466723_012182_158_1657 480
15 3300038395 Ga0415639_156688 Ga0415639_156688_2218_3678 486
16 3300042593 Ga0466691_135881 Ga0466691_135881_266_1777 491
17 3300042592 Ga0466693_039697 Ga0466693_039697_288_1823 495
18 3300042643 Ga0466704_225187 Ga0466704_225187_1989_3479 496
19 3300010049 Ga0123356_10014436 Ga0123356_100144364 497
20 3300042616 Ga0466715_283457 Ga0466715_283457_592_2085 497
21 3300042620 Ga0466728_399182 Ga0466728_399182_289_1818 497
22 3300042636 Ga0466703_052185 Ga0466703_052185_1778_3271 497
23 3300009784 Ga0123357_10194189 Ga0123357_101941893 498
24 3300042610 Ga0466698_227828 Ga0466698_227828_250_1746 498
25 3300042612 Ga0466705_149674 Ga0466705_149674_53328_54824 498
26 3300005083 Ga0068305_10083773 Ga0068305_100837731 499
27 3300010049 Ga0123356_10085274 Ga0123356_100852742 499
28 3300010167 Ga0123353_10333701 Ga0123353_103337011 499
29 3300042598 Ga0466701_080036 Ga0466701_080036_284_1783 499
30 3300042582 Ga0466657_028602 Ga0466657_028602_1639_3177 500
31 3300042592 Ga0466693_256019 Ga0466693_256019_244_1782 500
32 3300042600 Ga0466700_182489 Ga0466700_182489_306_1844 500
33 3300042600 Ga0466700_218468 Ga0466700_218468_152_1690 500
34 3300042612 Ga0466705_021961 Ga0466705_021961_5931_7469 500
35 3300042620 Ga0466728_107250 Ga0466728_107250_1489_2991 500
36 3300042652 Ga0466708_287478 Ga0466708_287478_152_1654 500
37 3300042593 Ga0466691_032899 Ga0466691_032899_505_2010 501
38 3300042596 Ga0466696_479103 Ga0466696_479103_1183_2688 501
39 3300042604 Ga0466717_115102 Ga0466717_115102_15_1520 501
40 3300042608 Ga0466721_393376 Ga0466721_393376_365_1870 501
41 3300042611 Ga0466697_180988 Ga0466697_180988_179_1720 501
42 3300042617 Ga0466718_019174 Ga0466718_019174_236_1774 501
43 3300042618 Ga0466723_080080 Ga0466723_080080_141_1646 501
44 3300010049 Ga0123356_10228167 Ga0123356_102281671 502
45 3300042606 Ga0466719_064099 Ga0466719_064099_2132_3640 502
46 3300042615 Ga0466711_178734 Ga0466711_178734_632_2164 502
47 3300042594 Ga0466694_285032 Ga0466694_285032_455_1987 503
48 3300042622 Ga0466731_192539 Ga0466731_192539_113_1624 503
49 3300042636 Ga0466703_433033 Ga0466703_433033_293_1825 503
50 3300002450 JGI24695J34938_10050882 JGI24695J34938_100508821 504
51 3300010167 Ga0123353_10485359 Ga0123353_104853591 504
52 3300042605 Ga0466716_363762 Ga0466716_363762_494_2008 504
53 3300042612 Ga0466705_218567 Ga0466705_218567_1152_2666 504
54 3300042615 Ga0466711_002399 Ga0466711_002399_1508_3022 504
55 3300042636 Ga0466703_364213 Ga0466703_364213_459_1997 504
56 3300010049 Ga0123356_10214994 Ga0123356_102149941 505
57 3300024493 Ga0264413_131440 Ga0264413_1314401 505
58 3300042590 Ga0466690_161968 Ga0466690_161968_133_1650 505
59 3300042596 Ga0466696_320534 Ga0466696_320534_3305_4822 505
60 3300042607 Ga0466720_193364 Ga0466720_193364_35_1552 505
61 3300042612 Ga0466705_531539 Ga0466705_531539_530_2062 505
62 3300042618 Ga0466723_297470 Ga0466723_297470_340_1872 505
63 3300042655 Ga0466727_192731 Ga0466727_192731_888_2405 505
64 3300042655 Ga0466727_302259 Ga0466727_302259_81_1598 505
65 3300042659 Ga0466733_187567 Ga0466733_187567_240_1793 505
66 3300010167 Ga0123353_10078884 Ga0123353_100788842 506
67 3300038395 Ga0415639_053462 Ga0415639_053462_569_2089 506
68 3300042594 Ga0466694_374017 Ga0466694_374017_789_2309 506
69 3300042604 Ga0466717_185389 Ga0466717_185389_258_1778 506
70 3300042611 Ga0466697_037267 Ga0466697_037267_1619_3139 506
71 3300042611 Ga0466697_225584 Ga0466697_225584_382_1902 506
72 3300042616 Ga0466715_046271 Ga0466715_046271_162_1682 506
73 3300042616 Ga0466715_376582 Ga0466715_376582_1692_3212 506
74 3300042622 Ga0466731_275374 Ga0466731_275374_248_1768 506
75 3300042622 Ga0466731_291019 Ga0466731_291019_267_1787 506
76 3300002462 JGI24702J35022_10077514 JGI24702J35022_100775142 507
77 3300002504 JGI24705J35276_12223734 JGI24705J35276_122237343 507
78 3300010049 Ga0123356_10214524 Ga0123356_102145241 507
79 3300042592 Ga0466693_110322 Ga0466693_110322_665_2188 507
80 3300042594 Ga0466694_279765 Ga0466694_279765_745_2283 507
81 3300042600 Ga0466700_032555 Ga0466700_032555_441_1964 507
82 3300005201 Ga0072941_1056103 Ga0072941_10561036 508
83 3300042590 Ga0466690_337239 Ga0466690_337239_293_1819 508
84 3300042594 Ga0466694_050881 Ga0466694_050881_229_1755 508
85 3300042595 Ga0466695_313675 Ga0466695_313675_267_1793 508
86 3300042604 Ga0466717_038525 Ga0466717_038525_243_1769 508
87 3300042605 Ga0466716_200709 Ga0466716_200709_327_1853 508
88 3300042611 Ga0466697_169390 Ga0466697_169390_199_1746 508
89 3300042617 Ga0466718_073995 Ga0466718_073995_246_1772 508
90 3300042605 Ga0466716_370411 Ga0466716_370411_71_1600 509
91 3300042611 Ga0466697_004161 Ga0466697_004161_941_2470 509
92 3300042590 Ga0466690_391102 Ga0466690_391102_201_1733 510
93 3300042604 Ga0466717_052975 Ga0466717_052975_62_1594 510
94 3300042606 Ga0466719_267005 Ga0466719_267005_1063_2595 510
95 3300042618 Ga0466723_240639 Ga0466723_240639_624_2156 510
96 3300042618 Ga0466723_343127 Ga0466723_343127_554_2107 510
97 3300042620 Ga0466728_280473 Ga0466728_280473_512_2044 510
98 3300005201 Ga0072941_1188479 Ga0072941_11884792 511
99 3300010049 Ga0123356_10144267 Ga0123356_101442672 511
100 3300042596 Ga0466696_330743 Ga0466696_330743_550_2085 511
101 3300042618 Ga0466723_227439 Ga0466723_227439_134_1669 511
102 3300042618 Ga0466723_259195 Ga0466723_259195_2089_3624 511
103 2225789004 2227626294 2228207891 512
104 3300000062 IMNBL1DRAFT_c0026936 IMNBL1DRAFT_00269361 512
105 3300042600 Ga0466700_237127 Ga0466700_237127_128_1666 512
106 3300042604 Ga0466717_038805 Ga0466717_038805_19_1557 512
107 3300042652 Ga0466708_072517 Ga0466708_072517_1446_2984 512
108 iso_pr_bacteria 2820220859 2820223324 512
109 3300002462 JGI24702J35022_10009624 JGI24702J35022_100096244 513
110 3300042611 Ga0466697_054190 Ga0466697_054190_155_1696 513
111 3300042605 Ga0466716_235156 Ga0466716_235156_221_1786 514
112 3300042615 Ga0466711_502946 Ga0466711_502946_349_1893 514
113 3300042600 Ga0466700_192393 Ga0466700_192393_788_2335 515
114 3300042608 Ga0466721_152729 Ga0466721_152729_71_1618 515
115 3300042636 Ga0466703_102686 Ga0466703_102686_366_1913 515
116 3300042636 Ga0466703_130569 Ga0466703_130569_692_2242 516
117 3300042612 Ga0466705_485491 Ga0466705_485491_25_1578 517
118 3300042601 Ga0466707_421183 Ga0466707_421183_1739_3295 518
119 3300042606 Ga0466719_209934 Ga0466719_209934_305_1861 518
120 3300042597 Ga0466699_030879 Ga0466699_030879_249_1826 519
121 3300010167 Ga0123353_10391733 Ga0123353_103917332 520
122 3300042601 Ga0466707_054930 Ga0466707_054930_1613_3178 521
123 3300042659 Ga0466733_011784 Ga0466733_011784_902_2503 521
124 3300042600 Ga0466700_126277 Ga0466700_126277_551_2119 522
125 3300042590 Ga0466690_213508 Ga0466690_213508_390_2099 544

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01609 DDE_Tnp_1 Transposase DDE domain 183 434 0.95

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.71 0.75 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.