Protein Family IF04508

Metagenome Isolate
151 Members
34 Samples
147 Scaffolds
448.05 Avg Length

🧬 Representative Sequence

ID
3300042590|Ga0466690_152887|Ga0466690_152887_3916_5430
Length
504 aa
Sequence
MRPNSEMETVLPVSSKALFRSNAACSCRRRGAVFPCIEFQAHPCYSASLKETSMIVMKFGGSSVANAERIRRVAEIVKPRIAEKPALVLSAMGDTTDYLLEAASAALQGGAVSIERIVDLHQGAMAELGLGDRAAAELESLVGELRSLLTGIALIKELSDKTRDYLVSFGERLSVRLVAAYLNSIGVQARAMDAWDAGLLSDSNFSFAELDEDSWNRVPLALSPLIEEGTLPVITGFIAKDRQGNITTLGRGGSDLSATFIAAAMGAAEVQVWKDVDGILTADPRLVKNARPVETVSYEEAAELAYFGAQVLHPRAMQPCIKTGAVVRVKNSYNPQAEGTRIIARVDKKAGPVRAITSRKNVTLVDIVSTRMVGQYGFLAEVFAAFANHKLSVDMVATSEVSISLTLDAAHDLEKLRRDLSKIADVEIKTGKAIVTIIGDVRRSSEILQRAFGTCVLLGIQVQMISQGASKVNISFIVDGSQAGEVVAALHQCFFEPLNEEALG

📊 Sample Types

Isolate 2.6%
Metagenome 97.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 42.4%
Termitidae 21.2%
Unclassified 18.2%
Termopsidae 9.1%
Rhinotermitidae 6.1%
Blaberidae 3.0%

🌳 Taxonomy

Archaea 1
Bacteria 145
Eukaryota 0
Viruses 0
Unclassified 5

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2772190975 Treponema sp. RmG30 Isolate Blaberidae
2 650716102 Treponema primitia ZAS-2 Isolate Unclassified
3 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
4 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
5 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
6 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
7 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
8 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
9 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
10 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
11 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
12 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
13 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
14 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
15 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
16 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
17 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
18 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
19 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
20 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
21 2781125653 Treponema sp. Emb289P1bin107 Isolate Unclassified
22 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
23 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
24 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
25 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
26 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
27 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
28 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
29 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
30 2781125690 Treponema sp. Th196P3bin63 Isolate Unclassified
31 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
32 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
33 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
34 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466715_154919 3300042616 Bacteria 14311
2 Ga0466723_088657 3300042618 Bacteria 4001
3 Ga0466723_194702 3300042618 Bacteria 2682
4 Ga0466726_058806 3300042619 Bacteria 5585
5 Ga0466722_105240 3300042609 Bacteria 1894
6 Ga0466722_179064 3300042609 Bacteria 7349
7 Ga0466694_048108 3300042594 Bacteria 2481
8 Ga0466696_018317 3300042596 Unclassified 14126
9 Ga0466696_076705 3300042596 Bacteria 14008
10 Ga0466704_086443 3300042643 Bacteria 4757
11 Ga0466704_312033 3300042643 Bacteria 7358
12 Ga0466709_259608 3300042648 Bacteria 8752
13 Ga0466708_013013 3300042652 Bacteria 5360
14 Ga0466727_172398 3300042655 Bacteria 2572
15 Ga0466705_180803 3300042612 Bacteria 12619
16 Ga0466723_160805 3300042618 Bacteria 4966
17 Ga0466723_171803 3300042618 Bacteria 59143
18 Ga0466723_196144 3300042618 Bacteria 3170
19 Ga0466723_298435 3300042618 Bacteria 4343
20 Ga0466690_040677 3300042590 Bacteria 3104
21 Ga0466690_275648 3300042590 Bacteria 3997
22 Ga0466703_065803 3300042636 Bacteria 8199
23 Ga0466703_173156 3300042636 Bacteria 10084
24 Ga0466703_265854 3300042636 Bacteria 5449
25 Ga0466704_448806 3300042643 Unclassified 7611
26 Ga0466709_101846 3300042648 Bacteria 4145
27 Ga0466705_351091 3300042612 Bacteria 6034
28 Ga0466705_441272 3300042612 Bacteria 3253
29 Ga0466715_099637 3300042616 Bacteria 16149
30 Ga0466723_358413 3300042618 Bacteria 6322
31 Ga0466728_020618 3300042620 Bacteria 3906
32 Ga0466729_188114 3300042621 Bacteria 8970
33 Ga0123355_10099297 3300009826 Unclassified 4588
34 Ga0466707_396803 3300042601 Bacteria 1670
35 Ga0466716_139895 3300042605 Bacteria 3087
36 Ga0466719_048724 3300042606 Bacteria 3149
37 Ga0466719_094719 3300042606 Bacteria 35699
38 Ga0466719_156740 3300042606 Bacteria 21000
39 Ga0466719_251791 3300042606 Bacteria 13678
40 Ga0466690_184731 3300042590 Bacteria 8122
41 Ga0466691_050524 3300042593 Bacteria 6730
42 Ga0466691_109239 3300042593 Bacteria 13044
43 Ga0466696_252281 3300042596 Bacteria 2991
44 Ga0466703_337031 3300042636 Bacteria 4170
45 Ga0466704_361173 3300042643 Bacteria 24999
46 Ga0466704_379441 3300042643 Bacteria 22236
47 Ga0466727_214161 3300042655 Bacteria 1441
48 Ga0466711_001519 3300042615 Bacteria 36988
49 Ga0466711_233862 3300042615 Bacteria 2894
50 Ga0466715_106710 3300042616 Bacteria 8951
51 Ga0466715_355095 3300042616 Bacteria 1755
52 Ga0466723_173837 3300042618 Bacteria 38157
53 Ga0466726_053327 3300042619 Bacteria 10018
54 Ga0466726_490200 3300042619 Bacteria 14288
55 Ga0466728_103025 3300042620 Bacteria 2497
56 Ga0466729_049644 3300042621 Bacteria 1722
57 Ga0466729_095525 3300042621 Bacteria 3433
58 Ga0466713_018861 3300042602 Bacteria 22862
59 Ga0466716_347127 3300042605 Bacteria 15723
60 Ga0466691_013172 3300042593 Bacteria 11157
61 Ga0466691_150659 3300042593 Bacteria 5832
62 Ga0466695_405588 3300042595 Bacteria 3656
63 Ga0466696_103818 3300042596 Bacteria 13702
64 Ga0466735_084570 3300042624 Bacteria 4005
65 Ga0466703_135693 3300042636 Bacteria 3728
66 Ga0466709_127328 3300042648 Bacteria 2990
67 Ga0466727_106716 3300042655 Bacteria 2293
68 Ga0466727_230491 3300042655 Bacteria 44965
69 AustNasuHG_c1006958 3300000089 Bacteria 4030
70 Ga0466705_138823 3300042612 Bacteria 3705
71 Ga0466705_366553 3300042612 Bacteria 7041
72 Ga0466733_008849 3300042659 Bacteria 1464
73 Ga0466705_488971 3300042612 Bacteria 7617
74 Ga0466723_304311 3300042618 Bacteria 3892
75 Ga0466726_356043 3300042619 Archaea 3264
76 Ga0466726_469940 3300042619 Bacteria 3157
77 Ga0466728_063252 3300042620 Bacteria 5206
78 Ga0466728_171590 3300042620 Bacteria 2740
79 Ga0466690_152887 3300042590 Bacteria 11754
80 Ga0466696_113986 3300042596 Bacteria 2551
81 Ga0466704_150223 3300042643 Bacteria 17277
82 Ga0466704_347788 3300042643 Bacteria 1563
83 Ga0466727_321693 3300042655 Bacteria 2642
84 Ga0466705_162796 3300042612 Unclassified 3860
85 Ga0466715_098690 3300042616 Bacteria 13525
86 Ga0466723_006517 3300042618 Bacteria 14855
87 Ga0466723_096020 3300042618 Bacteria 11191
88 Ga0466726_350598 3300042619 Bacteria 2872
89 Ga0466728_137750 3300042620 Bacteria 3576
90 Ga0466707_173865 3300042601 Bacteria 1640
91 Ga0466691_013939 3300042593 Bacteria 6967
92 Ga0466691_025299 3300042593 Bacteria 2691
93 Ga0466691_120345 3300042593 Bacteria 13092
94 Ga0466691_130705 3300042593 Bacteria 12220
95 Ga0466696_082242 3300042596 Bacteria 11475
96 Ga0466703_027550 3300042636 Bacteria 11089
97 Ga0466709_234621 3300042648 Bacteria 8009
98 Ga0466708_109511 3300042652 Bacteria 32313
99 Ga0466708_169094 3300042652 Bacteria 3622
100 Ga0466708_206800 3300042652 Bacteria 16211
101 Ga0466708_322281 3300042652 Bacteria 15490
102 Ga0466708_464475 3300042652 Bacteria 69222
103 Ga0068305_10032411 3300005083 Bacteria 7707
104 Ga0466705_262070 3300042612 Bacteria 3045
105 Ga0466733_004926 3300042659 Bacteria 4517
106 Ga0466733_165470 3300042659 Bacteria 3230
107 Ga0466715_086582 3300042616 Bacteria 6630
108 Ga0466715_174577 3300042616 Bacteria 2974
109 Ga0466715_270970 3300042616 Bacteria 3036
110 Ga0466718_054226 3300042617 Bacteria 1592
111 Ga0466728_078215 3300042620 Bacteria 4596
112 Ga0466716_066787 3300042605 Bacteria 4976
113 Ga0466716_247787 3300042605 Bacteria 10104
114 Ga0466719_276867 3300042606 Bacteria 13939
115 Ga0466722_191203 3300042609 Bacteria 5411
116 Ga0466722_200719 3300042609 Bacteria 11500
117 Ga0466690_004849 3300042590 Bacteria 3454
118 Ga0466691_023784 3300042593 Bacteria 15484
119 Ga0466696_072579 3300042596 Bacteria 12290
120 Ga0466703_195089 3300042636 Bacteria 2742
121 Ga0466708_023393 3300042652 Bacteria 3961
122 Ga0466727_259956 3300042655 Bacteria 4233
123 Ga0466727_327788 3300042655 Bacteria 14506
124 Ga0466705_005917 3300042612 Unclassified 4214
125 Ga0466711_278536 3300042615 Bacteria 2764
126 Ga0466711_509250 3300042615 Bacteria 7534
127 Ga0466723_090103 3300042618 Bacteria 1503
128 Ga0466728_356934 3300042620 Bacteria 7862
129 Ga0123355_10270537 3300009826 Bacteria 2361
130 Ga0466716_027907 3300042605 Bacteria 11091
131 Ga0466716_497274 3300042605 Bacteria 27635
132 Ga0466722_156350 3300042609 Bacteria 15490
133 Ga0264413_128997 3300024493 Bacteria 4807
134 Ga0466690_011760 3300042590 Bacteria 15760
135 Ga0466690_220746 3300042590 Bacteria 1885
136 Ga0466690_225351 3300042590 Bacteria 11622
137 Ga0466691_073252 3300042593 Bacteria 4393
138 Ga0466691_102279 3300042593 Bacteria 4705
139 Ga0466691_106456 3300042593 Bacteria 7416
140 Ga0466735_035377 3300042624 Bacteria 6944
141 Ga0466703_140860 3300042636 Bacteria 5582
142 Ga0466703_302811 3300042636 Bacteria 16476
143 Ga0466704_059873 3300042643 Bacteria 9066
144 Ga0466704_090443 3300042643 Bacteria 2079
145 Ga0466709_061036 3300042648 Bacteria 13570
146 Ga0466708_218025 3300042652 Bacteria 18464
147 Ga0072940_1068665 3300005200 Bacteria 2417

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF22468 ACT_9 ACT domain 435 494 0.97
PF00696 AA_kinase Amino acid kinase family 54 331 0.89

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.