Protein Family IF04495
Metagenome
152
Members
32
Samples
152
Scaffolds
320.22
Avg Length
Representative Sequence
- ID
- 3300042590|Ga0466690_116637|Ga0466690_116637_25203_26282
- Length
- 359 aa
- Sequence
- MSDLLQGKNAPILTTEIGPDIAIPTGKKLFLLLKDTSGKVVSKPGFNWRILIPLVSLGLVLVLHRIIPTHPRYRVKELPYFPLFIYLLLGVFTGWGLVGVVNRKHREHLAYKSWFFAVAFLVLSAYDLITIKFNLIPSLYFPAPERIIEVFIKEWWFILQCLVYSLRLLLGGFVLGAFLGVLTGTFIGWSQRWNYWIMPFIRIVGPIPSTAWIPIALVVFTKATDASLFLIALGVWFPTTILTSSGILNVQKTYFEVSSTLGASSLRNILSIALPAAAPSIFVGIFNGTSASFLTLMAAEMIGCKFGIGWYINWQRETLAYPHVYAALIVIAFTFSLLINLQFKIRNKVLNWQKGTIRW
Sample Types
Isolate
0.0%
Metagenome
100.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
43.3%
Termitidae
23.3%
Rhinotermitidae
13.3%
Unclassified
10.0%
Termopsidae
10.0%
Taxonomy
Archaea
0
Bacteria
140
Eukaryota
0
Viruses
0
Unclassified
12
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 2 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 3 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 4 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 5 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 6 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 7 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 8 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 9 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 10 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 11 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 12 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 13 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 14 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 15 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 16 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 17 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 18 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 19 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 20 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 21 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 22 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 23 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 24 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 25 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 26 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 27 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 28 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 29 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 30 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 31 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 32 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_216081 | 3300042612 | Bacteria | 5107 |
| 2 | JGI24698J34947_10024954 | 3300002449 | Bacteria | 3186 |
| 3 | Ga0072941_1008033 | 3300005201 | Bacteria | 12289 |
| 4 | Ga0072941_1042219 | 3300005201 | Bacteria | 4993 |
| 5 | Ga0466715_138941 | 3300042616 | Bacteria | 3788 |
| 6 | Ga0466723_028591 | 3300042618 | Bacteria | 13610 |
| 7 | Ga0466723_146674 | 3300042618 | Bacteria | 52032 |
| 8 | Ga0466726_166203 | 3300042619 | Bacteria | 3715 |
| 9 | Ga0466726_167638 | 3300042619 | Bacteria | 1716 |
| 10 | Ga0466726_255083 | 3300042619 | Bacteria | 39094 |
| 11 | Ga0466735_007896 | 3300042624 | Bacteria | 2391 |
| 12 | Ga0466703_068595 | 3300042636 | Bacteria | 20155 |
| 13 | Ga0466704_087204 | 3300042643 | Bacteria | 41764 |
| 14 | Ga0466708_075290 | 3300042652 | Bacteria | 12201 |
| 15 | Ga0466707_103594 | 3300042601 | Bacteria | 16162 |
| 16 | Ga0466716_372708 | 3300042605 | Bacteria | 18312 |
| 17 | Ga0466719_247502 | 3300042606 | Bacteria | 1337 |
| 18 | Ga0466722_173624 | 3300042609 | Bacteria | 1794 |
| 19 | Ga0466722_233733 | 3300042609 | Bacteria | 5744 |
| 20 | JGI24698J34947_10039439 | 3300002449 | Unclassified | 2445 |
| 21 | Ga0466711_046320 | 3300042615 | Bacteria | 10922 |
| 22 | Ga0466711_376714 | 3300042615 | Bacteria | 40639 |
| 23 | Ga0466715_221065 | 3300042616 | Bacteria | 14621 |
| 24 | Ga0466723_051952 | 3300042618 | Bacteria | 20182 |
| 25 | Ga0466723_102217 | 3300042618 | Bacteria | 5272 |
| 26 | Ga0466723_301124 | 3300042618 | Bacteria | 3869 |
| 27 | Ga0466728_058149 | 3300042620 | Bacteria | 1630 |
| 28 | Ga0466728_352081 | 3300042620 | Bacteria | 2011 |
| 29 | Ga0466735_036793 | 3300042624 | Bacteria | 2717 |
| 30 | Ga0466704_146487 | 3300042643 | Bacteria | 3903 |
| 31 | Ga0466709_099735 | 3300042648 | Unclassified | 1624 |
| 32 | Ga0466708_145610 | 3300042652 | Bacteria | 5319 |
| 33 | Ga0466708_214518 | 3300042652 | Bacteria | 4250 |
| 34 | Ga0466727_327368 | 3300042655 | Bacteria | 6509 |
| 35 | Ga0466716_515624 | 3300042605 | Bacteria | 2416 |
| 36 | Ga0466719_282316 | 3300042606 | Bacteria | 2330 |
| 37 | Ga0466722_183927 | 3300042609 | Bacteria | 11251 |
| 38 | Ga0456237_0001303 | 3300041968 | Bacteria | 3955 |
| 39 | Ga0466692_002160 | 3300042591 | Unclassified | 1864 |
| 40 | Ga0466692_161220 | 3300042591 | Bacteria | 3490 |
| 41 | Ga0466691_216707 | 3300042593 | Bacteria | 3680 |
| 42 | Ga0466691_227106 | 3300042593 | Bacteria | 1887 |
| 43 | Ga0068305_10211808 | 3300005083 | Bacteria | 21588 |
| 44 | Ga0072940_1006504 | 3300005200 | Bacteria | 4805 |
| 45 | Ga0466712_037672 | 3300042614 | Bacteria | 53460 |
| 46 | Ga0466711_138997 | 3300042615 | Bacteria | 3645 |
| 47 | Ga0466726_010422 | 3300042619 | Bacteria | 3881 |
| 48 | Ga0466704_543626 | 3300042643 | Unclassified | 4195 |
| 49 | Ga0466708_064419 | 3300042652 | Bacteria | 23359 |
| 50 | Ga0466716_414860 | 3300042605 | Bacteria | 15687 |
| 51 | Ga0466719_024295 | 3300042606 | Bacteria | 3495 |
| 52 | Ga0466719_507158 | 3300042606 | Bacteria | 2494 |
| 53 | Ga0264413_119980 | 3300024493 | Bacteria | 6640 |
| 54 | Ga0466690_070352 | 3300042590 | Bacteria | 4592 |
| 55 | Ga0466691_135432 | 3300042593 | Bacteria | 2122 |
| 56 | Ga0466705_183299 | 3300042612 | Bacteria | 5378 |
| 57 | Ga0466732_007580 | 3300042656 | Bacteria | 31571 |
| 58 | Ga0072941_1000583 | 3300005201 | Bacteria | 39939 |
| 59 | Ga0466712_003119 | 3300042614 | Unclassified | 3168 |
| 60 | Ga0466711_006993 | 3300042615 | Bacteria | 14196 |
| 61 | Ga0466723_146355 | 3300042618 | Bacteria | 13706 |
| 62 | Ga0466726_334805 | 3300042619 | Bacteria | 5830 |
| 63 | Ga0466735_120943 | 3300042624 | Unclassified | 1140 |
| 64 | Ga0466704_069592 | 3300042643 | Bacteria | 9786 |
| 65 | Ga0466704_084651 | 3300042643 | Bacteria | 24091 |
| 66 | Ga0466708_003501 | 3300042652 | Bacteria | 8177 |
| 67 | Ga0466708_006777 | 3300042652 | Bacteria | 17314 |
| 68 | Ga0466727_097771 | 3300042655 | Bacteria | 6245 |
| 69 | Ga0466719_171330 | 3300042606 | Bacteria | 7638 |
| 70 | Ga0466719_244818 | 3300042606 | Bacteria | 3944 |
| 71 | Ga0466722_210891 | 3300042609 | Bacteria | 1908 |
| 72 | Ga0264413_126751 | 3300024493 | Bacteria | 3329 |
| 73 | Ga0466690_297234 | 3300042590 | Bacteria | 3697 |
| 74 | Ga0466690_314175 | 3300042590 | Bacteria | 14685 |
| 75 | Ga0466690_377605 | 3300042590 | Bacteria | 1529 |
| 76 | Ga0466690_381146 | 3300042590 | Bacteria | 6555 |
| 77 | Ga0466691_021012 | 3300042593 | Bacteria | 14993 |
| 78 | Ga0466705_288796 | 3300042612 | Bacteria | 9538 |
| 79 | JGI24698J34947_10009155 | 3300002449 | Bacteria | 5432 |
| 80 | Ga0466711_018326 | 3300042615 | Bacteria | 17962 |
| 81 | Ga0466723_298779 | 3300042618 | Bacteria | 58508 |
| 82 | Ga0466726_152042 | 3300042619 | Bacteria | 1863 |
| 83 | Ga0466726_340204 | 3300042619 | Bacteria | 7568 |
| 84 | Ga0466728_093000 | 3300042620 | Bacteria | 34506 |
| 85 | Ga0466728_181090 | 3300042620 | Bacteria | 3972 |
| 86 | Ga0466702_205452 | 3300042635 | Bacteria | 4820 |
| 87 | Ga0466704_243621 | 3300042643 | Bacteria | 30465 |
| 88 | Ga0466708_015194 | 3300042652 | Bacteria | 30430 |
| 89 | Ga0466707_156192 | 3300042601 | Bacteria | 1567 |
| 90 | Ga0466716_356447 | 3300042605 | Bacteria | 8637 |
| 91 | Ga0466719_350731 | 3300042606 | Bacteria | 7749 |
| 92 | Ga0466690_151400 | 3300042590 | Bacteria | 3079 |
| 93 | Ga0466705_098807 | 3300042612 | Bacteria | 8918 |
| 94 | Ga0466705_365502 | 3300042612 | Bacteria | 3586 |
| 95 | Ga0466712_139694 | 3300042614 | Bacteria | 3042 |
| 96 | Ga0466715_433027 | 3300042616 | Bacteria | 2407 |
| 97 | Ga0466726_101600 | 3300042619 | Bacteria | 2092 |
| 98 | Ga0466728_058094 | 3300042620 | Unclassified | 3842 |
| 99 | Ga0466735_003675 | 3300042624 | Unclassified | 2966 |
| 100 | Ga0466704_276880 | 3300042643 | Bacteria | 8732 |
| 101 | Ga0466709_326904 | 3300042648 | Bacteria | 20599 |
| 102 | Ga0466708_231885 | 3300042652 | Bacteria | 11622 |
| 103 | Ga0466716_208222 | 3300042605 | Bacteria | 9830 |
| 104 | Ga0466716_241761 | 3300042605 | Bacteria | 3822 |
| 105 | Ga0466716_542848 | 3300042605 | Bacteria | 6589 |
| 106 | Ga0466719_205897 | 3300042606 | Bacteria | 2701 |
| 107 | Ga0466720_044701 | 3300042607 | Bacteria | 20572 |
| 108 | Ga0466691_027913 | 3300042593 | Bacteria | 52900 |
| 109 | Ga0466705_017602 | 3300042612 | Bacteria | 7396 |
| 110 | Ga0466705_272944 | 3300042612 | Bacteria | 7051 |
| 111 | Ga0466711_041827 | 3300042615 | Bacteria | 6132 |
| 112 | Ga0466715_055964 | 3300042616 | Bacteria | 7684 |
| 113 | Ga0466715_228143 | 3300042616 | Bacteria | 3001 |
| 114 | Ga0466726_276996 | 3300042619 | Bacteria | 3314 |
| 115 | Ga0466735_055840 | 3300042624 | Unclassified | 1700 |
| 116 | Ga0466703_060909 | 3300042636 | Bacteria | 24088 |
| 117 | Ga0466703_158468 | 3300042636 | Bacteria | 9895 |
| 118 | Ga0466703_267250 | 3300042636 | Bacteria | 2548 |
| 119 | Ga0466704_099677 | 3300042643 | Bacteria | 1399 |
| 120 | Ga0466709_008441 | 3300042648 | Bacteria | 7920 |
| 121 | Ga0466709_030663 | 3300042648 | Bacteria | 3649 |
| 122 | Ga0466709_050299 | 3300042648 | Bacteria | 3787 |
| 123 | Ga0466708_153561 | 3300042652 | Bacteria | 12920 |
| 124 | Ga0466727_030956 | 3300042655 | Bacteria | 11790 |
| 125 | Ga0466713_135204 | 3300042602 | Bacteria | 16943 |
| 126 | Ga0466722_152784 | 3300042609 | Bacteria | 3013 |
| 127 | Ga0466690_050415 | 3300042590 | Bacteria | 12913 |
| 128 | Ga0466692_100438 | 3300042591 | Bacteria | 4181 |
| 129 | Ga0466691_107913 | 3300042593 | Bacteria | 27189 |
| 130 | Ga0466705_022498 | 3300042612 | Bacteria | 22340 |
| 131 | AustNasuHG_c1005856 | 3300000089 | Bacteria | 4392 |
| 132 | Ga0072940_1006682 | 3300005200 | Bacteria | 4675 |
| 133 | Ga0466711_411560 | 3300042615 | Bacteria | 21637 |
| 134 | Ga0466715_192340 | 3300042616 | Bacteria | 10894 |
| 135 | Ga0466715_201580 | 3300042616 | Bacteria | 13843 |
| 136 | Ga0466723_046642 | 3300042618 | Bacteria | 5021 |
| 137 | Ga0466728_056388 | 3300042620 | Bacteria | 16145 |
| 138 | Ga0466729_273466 | 3300042621 | Unclassified | 1420 |
| 139 | Ga0466735_055010 | 3300042624 | Bacteria | 2530 |
| 140 | Ga0466709_010616 | 3300042648 | Bacteria | 18572 |
| 141 | Ga0466708_144542 | 3300042652 | Bacteria | 14655 |
| 142 | Ga0466727_134275 | 3300042655 | Bacteria | 3387 |
| 143 | Ga0466727_197208 | 3300042655 | Bacteria | 6033 |
| 144 | Ga0466727_295406 | 3300042655 | Unclassified | 1538 |
| 145 | Ga0466707_130701 | 3300042601 | Bacteria | 4742 |
| 146 | Ga0466716_079478 | 3300042605 | Bacteria | 4484 |
| 147 | Ga0466719_083615 | 3300042606 | Unclassified | 1394 |
| 148 | Ga0466722_095199 | 3300042609 | Bacteria | 11206 |
| 149 | Ga0466690_116637 | 3300042590 | Bacteria | 27342 |
| 150 | Ga0466690_140615 | 3300042590 | Bacteria | 5409 |
| 151 | Ga0466692_068427 | 3300042591 | Bacteria | 3882 |
| 152 | Ga0466691_052690 | 3300042593 | Bacteria | 31559 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00528 | BPD_transp_1 | Binding-protein-dependent transport system inner membrane component | 178 | 339 | 0.87 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.