Protein Family IF04443
Metagenome
Isolate
129
Members
42
Samples
128
Scaffolds
262.27
Avg Length
Representative Sequence
- ID
- 3300042590|Ga0466690_004218|Ga0466690_004218_263_1129
- Length
- 288 aa
- Sequence
- VAGIFSGSCLKTEVFKQLYLNFYKEQEMDIRNVMEQFSLKGKVAIVTGGGQGLGKSMALGLAQAGADIVIAARRIESALETKPIIEQEGVSCAVIKGDMRNESDIKEMVAQVLRKFGKIDVLFNNAGTWRGDDAEKVTTEDWKEVIDVNLTGPFIVSREVGTVMLRQGKGSIVNIASMSGMIVNTPQNQCAYNASKGGLIMLTKSMATEWALRGVRVNAICPGYMRTEMSEDRYQRKDPAIERWFSMTPMGRSGTTDELMGIAVYLASDASSFVTGAAYLVDGGYTAW
Sample Types
Isolate
0.8%
Metagenome
99.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
42.9%
Kalotermitidae
33.3%
Termopsidae
9.5%
Rhinotermitidae
7.1%
Unclassified
7.1%
Taxonomy
Archaea
0
Bacteria
114
Eukaryota
0
Viruses
0
Unclassified
15
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 2 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 3 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 4 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 5 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 6 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 7 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 8 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 9 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 10 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 11 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 12 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 13 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 14 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 15 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 16 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 17 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 18 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 19 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 20 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 21 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 22 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 23 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 24 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 25 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 26 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 27 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 28 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 29 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 30 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 31 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 32 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 33 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 34 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 35 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 36 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 37 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 38 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 39 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 40 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 41 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 42 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_047059 | 3300042612 | Unclassified | 14729 |
| 2 | Ga0415639_274480 | 3300038395 | Bacteria | 938 |
| 3 | Ga0466690_057140 | 3300042590 | Bacteria | 30420 |
| 4 | Ga0466694_289012 | 3300042594 | Bacteria | 9160 |
| 5 | Ga0466699_222343 | 3300042597 | Bacteria | 1529 |
| 6 | Ga0123354_10219652 | 3300010882 | Bacteria | 2024 |
| 7 | Ga0466705_524363 | 3300042612 | Unclassified | 2502 |
| 8 | Ga0466711_316815 | 3300042615 | Bacteria | 15777 |
| 9 | Ga0466715_255441 | 3300042616 | Unclassified | 3044 |
| 10 | Ga0466715_614332 | 3300042616 | Bacteria | 3875 |
| 11 | Ga0466718_073465 | 3300042617 | Bacteria | 3553 |
| 12 | Ga0466726_065901 | 3300042619 | Bacteria | 1697 |
| 13 | Ga0466726_248745 | 3300042619 | Bacteria | 5445 |
| 14 | JGI24698J34947_10008816 | 3300002449 | Bacteria | 5534 |
| 15 | Ga0466709_077132 | 3300042648 | Bacteria | 3747 |
| 16 | Ga0466719_049751 | 3300042606 | Bacteria | 9396 |
| 17 | Ga0466722_096075 | 3300042609 | Bacteria | 1518 |
| 18 | Ga0466722_227425 | 3300042609 | Bacteria | 3115 |
| 19 | Ga0466722_239481 | 3300042609 | Bacteria | 17575 |
| 20 | Ga0456237_0006489 | 3300041968 | Unclassified | 1834 |
| 21 | Ga0466694_000337 | 3300042594 | Bacteria | 2245 |
| 22 | Ga0466695_206585 | 3300042595 | Bacteria | 1430 |
| 23 | Ga0123357_10388227 | 3300009784 | Bacteria | 1286 |
| 24 | Ga0466711_173188 | 3300042615 | Bacteria | 3141 |
| 25 | Ga0466711_433399 | 3300042615 | Bacteria | 3022 |
| 26 | Ga0466723_178773 | 3300042618 | Bacteria | 30734 |
| 27 | Ga0466723_217357 | 3300042618 | Unclassified | 13246 |
| 28 | Ga0466728_033230 | 3300042620 | Bacteria | 3074 |
| 29 | Ga0466704_405682 | 3300042643 | Unclassified | 3052 |
| 30 | Ga0466709_390910 | 3300042648 | Unclassified | 3050 |
| 31 | Ga0466708_011430 | 3300042652 | Bacteria | 9295 |
| 32 | Ga0466732_176989 | 3300042656 | Bacteria | 5288 |
| 33 | Ga0466690_004218 | 3300042590 | Bacteria | 1804 |
| 34 | Ga0123357_10176396 | 3300009784 | Bacteria | 2511 |
| 35 | Ga0123357_10329798 | 3300009784 | Bacteria | 1493 |
| 36 | Ga0466705_482378 | 3300042612 | Bacteria | 4423 |
| 37 | Ga0466711_453305 | 3300042615 | Bacteria | 8345 |
| 38 | Ga0466715_434862 | 3300042616 | Unclassified | 3246 |
| 39 | Ga0466723_136206 | 3300042618 | Bacteria | 4755 |
| 40 | Ga0466723_345823 | 3300042618 | Bacteria | 9576 |
| 41 | Ga0466726_032019 | 3300042619 | Bacteria | 6887 |
| 42 | Ga0123357_10002329 | 3300009784 | Bacteria | 21101 |
| 43 | Ga0466735_038941 | 3300042624 | Bacteria | 15106 |
| 44 | Ga0466703_017463 | 3300042636 | Bacteria | 7285 |
| 45 | Ga0466704_066832 | 3300042643 | Bacteria | 3156 |
| 46 | Ga0466704_558322 | 3300042643 | Bacteria | 7843 |
| 47 | Ga0466704_565451 | 3300042643 | Bacteria | 25802 |
| 48 | Ga0466722_075921 | 3300042609 | Bacteria | 1357 |
| 49 | Ga0466722_123764 | 3300042609 | Bacteria | 17837 |
| 50 | Ga0466705_090205 | 3300042612 | Bacteria | 16148 |
| 51 | Ga0466691_023674 | 3300042593 | Bacteria | 4732 |
| 52 | Ga0466691_091533 | 3300042593 | Bacteria | 4101 |
| 53 | Ga0466696_241441 | 3300042596 | Bacteria | 21872 |
| 54 | Ga0123357_10042203 | 3300009784 | Bacteria | 6203 |
| 55 | Ga0123357_10130986 | 3300009784 | Unclassified | 3122 |
| 56 | Ga0466712_055054 | 3300042614 | Bacteria | 2405 |
| 57 | Ga0466712_080325 | 3300042614 | Bacteria | 3949 |
| 58 | Ga0466715_125238 | 3300042616 | Bacteria | 19442 |
| 59 | Ga0466723_154815 | 3300042618 | Unclassified | 3090 |
| 60 | JGI24702J35022_10084670 | 3300002462 | Bacteria | 1721 |
| 61 | Ga0466735_099903 | 3300042624 | Bacteria | 15007 |
| 62 | Ga0466709_000320 | 3300042648 | Bacteria | 1977 |
| 63 | Ga0466727_261793 | 3300042655 | Bacteria | 3504 |
| 64 | Ga0466700_127537 | 3300042600 | Bacteria | 4080 |
| 65 | Ga0466719_302383 | 3300042606 | Bacteria | 11586 |
| 66 | Ga0466690_134855 | 3300042590 | Bacteria | 1862 |
| 67 | Ga0466691_228364 | 3300042593 | Bacteria | 2507 |
| 68 | Ga0123353_10278717 | 3300010167 | Bacteria | 2570 |
| 69 | Ga0466705_502386 | 3300042612 | Bacteria | 7763 |
| 70 | Ga0466711_455637 | 3300042615 | Bacteria | 13201 |
| 71 | Ga0466723_229672 | 3300042618 | Bacteria | 2088 |
| 72 | Ga0466723_276238 | 3300042618 | Bacteria | 13587 |
| 73 | Ga0466709_346788 | 3300042648 | Bacteria | 21230 |
| 74 | Ga0466708_013352 | 3300042652 | Bacteria | 4441 |
| 75 | Ga0466708_026931 | 3300042652 | Bacteria | 55987 |
| 76 | Ga0466707_377478 | 3300042601 | Bacteria | 1557 |
| 77 | Ga0466690_372372 | 3300042590 | Unclassified | 8276 |
| 78 | Ga0466691_114768 | 3300042593 | Bacteria | 26967 |
| 79 | Ga0466694_207318 | 3300042594 | Bacteria | 1281 |
| 80 | Ga0466694_381929 | 3300042594 | Bacteria | 1450 |
| 81 | Ga0466696_062411 | 3300042596 | Bacteria | 4035 |
| 82 | Ga0466711_105581 | 3300042615 | Unclassified | 4421 |
| 83 | Ga0466709_296643 | 3300042648 | Bacteria | 6192 |
| 84 | Ga0466707_047639 | 3300042601 | Bacteria | 4732 |
| 85 | Ga0466707_131274 | 3300042601 | Bacteria | 2016 |
| 86 | Ga0466716_312637 | 3300042605 | Bacteria | 3299 |
| 87 | Ga0466692_138507 | 3300042591 | Bacteria | 28367 |
| 88 | Ga0466694_056769 | 3300042594 | Bacteria | 3665 |
| 89 | Ga0466712_039805 | 3300042614 | Bacteria | 2423 |
| 90 | Ga0466726_149558 | 3300042619 | Bacteria | 2897 |
| 91 | Ga0466726_257473 | 3300042619 | Bacteria | 1093 |
| 92 | JGI24702J35022_10071898 | 3300002462 | Bacteria | 1864 |
| 93 | Ga0068302_10567387 | 3300005071 | Bacteria | 1303 |
| 94 | Ga0072940_1117015 | 3300005200 | Bacteria | 1403 |
| 95 | Ga0466703_162083 | 3300042636 | Bacteria | 20381 |
| 96 | Ga0466708_020136 | 3300042652 | Bacteria | 19712 |
| 97 | Ga0466708_067207 | 3300042652 | Unclassified | 1114 |
| 98 | Ga0466707_003209 | 3300042601 | Bacteria | 1129 |
| 99 | Ga0466719_003433 | 3300042606 | Bacteria | 22908 |
| 100 | Ga0466719_460780 | 3300042606 | Bacteria | 37540 |
| 101 | Ga0466721_383436 | 3300042608 | Bacteria | 1676 |
| 102 | Ga0466698_164682 | 3300042610 | Bacteria | 3337 |
| 103 | Ga0466698_501245 | 3300042610 | Bacteria | 1517 |
| 104 | Ga0466705_209206 | 3300042612 | Bacteria | 7327 |
| 105 | Ga0466733_059185 | 3300042659 | Bacteria | 1486 |
| 106 | Ga0466692_049460 | 3300042591 | Bacteria | 1600 |
| 107 | Ga0466692_054849 | 3300042591 | Bacteria | 5945 |
| 108 | Ga0466691_094979 | 3300042593 | Bacteria | 13736 |
| 109 | Ga0466699_073034 | 3300042597 | Bacteria | 1626 |
| 110 | Ga0123356_10094854 | 3300010049 | Bacteria | 2850 |
| 111 | Ga0123353_10132685 | 3300010167 | Bacteria | 3996 |
| 112 | Ga0466715_598518 | 3300042616 | Bacteria | 13062 |
| 113 | Ga0466723_085326 | 3300042618 | Unclassified | 2317 |
| 114 | Ga0466723_234455 | 3300042618 | Bacteria | 13642 |
| 115 | Ga0466723_290816 | 3300042618 | Bacteria | 2847 |
| 116 | Ga0466726_004261 | 3300042619 | Bacteria | 2545 |
| 117 | Ga0466726_224135 | 3300042619 | Bacteria | 7007 |
| 118 | Ga0466726_316310 | 3300042619 | Bacteria | 1391 |
| 119 | JGI24698J34947_10000783 | 3300002449 | Bacteria | 15795 |
| 120 | JGI24698J34947_10102122 | 3300002449 | Bacteria | 1287 |
| 121 | Ga0068305_10915109 | 3300005083 | Bacteria | 4459 |
| 122 | Ga0466703_008474 | 3300042636 | Unclassified | 4351 |
| 123 | Ga0466727_234277 | 3300042655 | Bacteria | 4696 |
| 124 | Ga0466727_273746 | 3300042655 | Bacteria | 1485 |
| 125 | Ga0466707_294021 | 3300042601 | Bacteria | 1835 |
| 126 | Ga0466716_024164 | 3300042605 | Bacteria | 7620 |
| 127 | Ga0466716_047765 | 3300042605 | Bacteria | 1200 |
| 128 | Ga0466716_169861 | 3300042605 | Bacteria | 1650 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.