Protein Family IF04438
Metagenome
Isolate
267
Members
189
Samples
153
Scaffolds
249.57
Avg Length
Representative Sequence
- ID
- 3300042582|Ga0466657_378630|Ga0466657_378630_1030_1887
- Length
- 285 aa
- Sequence
- LPPSSIPKKARITDCVSIEIFSTGTPDFHTRLLRGLAMLLIPAIDLKDGHCVRLKQGDMDQSTTFGEDPAAMALKWVQAGARRLHLVDLNGAFAGKPQNHVAIKAILRAVGDDIPVQLGGGIRDLDTIERYIDNGLRYVIIGTAAVKNPGFLKDACSAFGGHIIVGLDAKDGKVATDGWSKLTGHEVADLGKKFEDYGVESIIYTDIGRDGMLSGINIEATVRLAQALTIPVIASGGLSNMADIENLCAVEDEGIEGVICGRAIYSGDLDFADAQARADELTGAG
Sample Types
Isolate
42.7%
Metagenome
57.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Coreidae
43.5%
Termitidae
12.5%
Unclassified
9.8%
Formicidae
8.2%
Kalotermitidae
7.1%
Culicidae
4.3%
Elmidae
3.8%
Rhinotermitidae
1.6%
Termopsidae
1.6%
Curculionidae
1.6%
Hydrophilidae
1.1%
Berytidae
1.1%
Largidae
1.1%
Alydidae
1.1%
Passalidae
0.5%
Drosophilidae
0.5%
Armadillidiidae
0.5%
Taxonomy
Archaea
0
Bacteria
253
Eukaryota
0
Viruses
0
Unclassified
14
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2864826666 | Acidovorax konjaci S00067 | Isolate | Elmidae |
| 2 | 2873571580 | Diaphorobacter sp. HDW4B | Isolate | Hydrophilidae |
| 3 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 4 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 5 | 3300002934 | Ant worker gut metagenome for colony PL005 | Metagenome | Formicidae |
| 6 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 7 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 8 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 9 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 10 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 11 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 12 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 13 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 14 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 15 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 16 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 17 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 18 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 19 | 8025716094 | Caballeronia zhejiangensis LZ028 | Isolate | Coreidae |
| 20 | 8101960468 | Caballeronia sp. AAUFL_F2_KS46 | Isolate | Coreidae |
| 21 | 8101988189 | Caballeronia sp. ATUFL_F1_KS4A | Isolate | Coreidae |
| 22 | 8102014801 | Caballeronia sp. ATUFL_M2_KS44 | Isolate | Coreidae |
| 23 | 8102060671 | Caballeronia sp. GAFFF2 | Isolate | Coreidae |
| 24 | 8102152052 | Caballeronia sp. LZ001 | Isolate | Coreidae |
| 25 | 8102208438 | Caballeronia sp. LZ032 | Isolate | Coreidae |
| 26 | 8102251710 | Caballeronia sp. LZ065 | Isolate | Coreidae |
| 27 | 8102279326 | Caballeronia sp. NCTM1 | Isolate | Coreidae |
| 28 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 29 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 30 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 31 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 32 | 2848339753 | Ephemeroptericola cinctiostellae F02 | Isolate | Unclassified |
| 33 | 2864914039 | Chromobacterium alkanivorans S00172 | Isolate | Elmidae |
| 34 | 2820121232 | Unclassified Proteobacteria Emb289P4bin32 | Isolate | Unclassified |
| 35 | 2820123897 | Unclassified Proteobacteria Emb289P4bin18 | Isolate | Unclassified |
| 36 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 37 | 3300007141 | Ant gut microbial communities from Cephalotes maculatus, Brazil | Metagenome | Formicidae |
| 38 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 39 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 40 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 41 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 42 | 8023724303 | Caballeronia zhejiangensis LP003 | Isolate | Coreidae |
| 43 | 8024001094 | Caballeronia sp. TF1N1 | Isolate | Berytidae |
| 44 | 8025666332 | Caballeronia grimmiae LZ050 | Isolate | Coreidae |
| 45 | 8025694439 | Caballeronia cordobensis LZ033 | Isolate | Coreidae |
| 46 | 8025701579 | Caballeronia telluris LZ031 | Isolate | Coreidae |
| 47 | 8101967387 | Caballeronia sp. AAUFL_F3_KS11A | Isolate | Coreidae |
| 48 | 8102007614 | Caballeronia sp. ATUFL_M1_KS5A | Isolate | Coreidae |
| 49 | 8102041249 | Caballeronia sp. GACF4 | Isolate | Coreidae |
| 50 | 8102087471 | Caballeronia sp. GAWG2-1 | Isolate | Coreidae |
| 51 | 8102201977 | Caballeronia sp. LZ031 | Isolate | Coreidae |
| 52 | 8102264549 | Caballeronia sp. NCF2 | Isolate | Coreidae |
| 53 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 54 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 55 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 56 | 2864968865 | Paucibacter oligotrophus S00239 | Isolate | Elmidae |
| 57 | 2873565274 | Diaphorobacter sp. HDW4A | Isolate | Hydrophilidae |
| 58 | 2518285616 | Brachymonas chironomi DSM 19884 | Isolate | Unclassified |
| 59 | 2603880165 | Burkholderiales A1 | Isolate | Unclassified |
| 60 | 2603880172 | Burkholderiales C | Isolate | Unclassified |
| 61 | 2820089333 | Unclassified Proteobacteria Lab288P3bin88 | Isolate | Unclassified |
| 62 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 63 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 64 | 8025658853 | Caballeronia temeraria LZ065 | Isolate | Coreidae |
| 65 | 8025708040 | Caballeronia jiangsuensis LZ029 | Isolate | Coreidae |
| 66 | 8069770227 | Caballeronia sp. LZ019 | Isolate | Coreidae |
| 67 | 8101994502 | Caballeronia sp. ATUFL_F2_KS42 | Isolate | Coreidae |
| 68 | 8102124461 | Caballeronia sp. INML3B | Isolate | Coreidae |
| 69 | 8102193924 | Caballeronia sp. LZ029 | Isolate | Coreidae |
| 70 | 8102312426 | Caballeronia sp. AAUFL_F1_KS47 | Isolate | Coreidae |
| 71 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 72 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 73 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 74 | 2864755708 | Massilia timonae S00006 | Isolate | Elmidae |
| 75 | 2820065746 | Unclassified Proteobacteria Nt197P3bin56 | Isolate | Unclassified |
| 76 | 2820084079 | Unclassified Proteobacteria Lab288P4bin103 | Isolate | Unclassified |
| 77 | 3003869270 | Paraburkholderia sp. PGU16 | Isolate | Largidae |
| 78 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 79 | 3300007042 | Ant gut microbial communities from Cephalotes pusillus, Brazil | Metagenome | Formicidae |
| 80 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 81 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 82 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 83 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 84 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 85 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 86 | 8023747282 | Caballeronia zhejiangensis LZ019 | Isolate | Coreidae |
| 87 | 8024025509 | Caballeronia grimmiae Lep1A1 | Isolate | Coreidae |
| 88 | 8024037630 | Caballeronia zhejiangensis A33_M4_a | Isolate | Coreidae |
| 89 | 8025685901 | Caballeronia fortuita LZ035 | Isolate | Coreidae |
| 90 | 8025723035 | Caballeronia grimmiae LZ025 | Isolate | Coreidae |
| 91 | 8025756023 | Caballeronia peredens LZ002 | Isolate | Coreidae |
| 92 | 8078130113 | Caballeronia sp. INDeC2 | Isolate | Coreidae |
| 93 | 8100455565 | Delftia sp. S67 | Isolate | Curculionidae |
| 94 | 8102054868 | Caballeronia sp. GAFFF1 | Isolate | Coreidae |
| 95 | 8102102351 | Caballeronia sp. INML1 | Isolate | Coreidae |
| 96 | 8102161003 | Caballeronia sp. LZ002 | Isolate | Coreidae |
| 97 | 8102174626 | Caballeronia sp. LZ024 | Isolate | Coreidae |
| 98 | 8102246966 | Caballeronia sp. LZ050 | Isolate | Coreidae |
| 99 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 100 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 101 | 2864937364 | Acidovorax soli S00198 | Isolate | Elmidae |
| 102 | 2891720358 | Azoarcus nasutitermitis CC-YHH838 | Isolate | Unclassified |
| 103 | 2963630348 | Burkholderiales bacterium 3487_49 | Isolate | Formicidae |
| 104 | 2820042117 | Unclassified Proteobacteria Th196P4bin58 | Isolate | Unclassified |
| 105 | 2820050117 | Unclassified Proteobacteria Th196P3bin129 | Isolate | Unclassified |
| 106 | 2820086750 | Unclassified Proteobacteria Lab288P3bin98 | Isolate | Unclassified |
| 107 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 108 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 109 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 110 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 111 | 8025650824 | Caballeronia hypogeia LZ032 | Isolate | Coreidae |
| 112 | 8025671076 | Caballeronia cordobensis LZ034LL | Isolate | Coreidae |
| 113 | 8025735396 | Caballeronia zhejiangensis LZ016 | Isolate | Coreidae |
| 114 | 8102047609 | Caballeronia sp. GACF5 | Isolate | Coreidae |
| 115 | 8102074813 | Caballeronia sp. GAWG1-1 | Isolate | Coreidae |
| 116 | 8102081745 | Caballeronia sp. GAWG1-5s-s | Isolate | Coreidae |
| 117 | 8102117041 | Caballeronia sp. INML3 | Isolate | Coreidae |
| 118 | 8102131453 | Caballeronia sp. INML5 | Isolate | Coreidae |
| 119 | 8102138357 | Caballeronia sp. INSB1 | Isolate | Coreidae |
| 120 | 8102216467 | Caballeronia sp. LZ033 | Isolate | Coreidae |
| 121 | 8102230706 | Caballeronia sp. LZ035 | Isolate | Coreidae |
| 122 | 8102239244 | Caballeronia sp. LZ043 | Isolate | Coreidae |
| 123 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 124 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 125 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 126 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 127 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 128 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 129 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 130 | 2864859030 | Chromobacterium alkanivorans S00115 | Isolate | Elmidae |
| 131 | 2864960361 | Comamonas odontotermitis S00229 | Isolate | Elmidae |
| 132 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 133 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 134 | 8023757577 | Caballeronia peredens LP006 | Isolate | Coreidae |
| 135 | 8023764196 | Caballeronia peredens LZ001 | Isolate | Coreidae |
| 136 | 8025678175 | Caballeronia hypogeia LZ043 | Isolate | Coreidae |
| 137 | 8025728939 | Caballeronia telluris LZ024 | Isolate | Coreidae |
| 138 | 8025747911 | Caballeronia peredens LZ003 | Isolate | Coreidae |
| 139 | 8069755105 | Caballeronia sp. LZ003 | Isolate | Coreidae |
| 140 | 8069775773 | Caballeronia sp. LZ062 | Isolate | Coreidae |
| 141 | 8100461708 | Delftia sp. S65 | Isolate | Curculionidae |
| 142 | 8101951471 | Caballeronia sp. AAUFL_F1_KS45 | Isolate | Coreidae |
| 143 | 8101974301 | Caballeronia sp. ASUFL_F2_KS49 | Isolate | Coreidae |
| 144 | 8101981714 | Caballeronia sp. ATUFL_F1_KS39 | Isolate | Coreidae |
| 145 | 8102020860 | Caballeronia sp. AZ10_KS36 | Isolate | Coreidae |
| 146 | 8102026984 | Caballeronia sp. AZ1_KS37 | Isolate | Coreidae |
| 147 | 8102067727 | Caballeronia sp. GAFFF3 | Isolate | Coreidae |
| 148 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 149 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 150 | 8024014383 | Caballeronia sp. SL2Y3 | Isolate | Berytidae |
| 151 | 8025740903 | Caballeronia zhejiangensis LZ008 | Isolate | Coreidae |
| 152 | 8069748016 | Caballeronia sp. LP003 | Isolate | Coreidae |
| 153 | 8102033761 | Caballeronia sp. AZ7_KS35 | Isolate | Coreidae |
| 154 | 8102094248 | Caballeronia sp. GaOx3 | Isolate | Coreidae |
| 155 | 8102109360 | Caballeronia sp. INML2 | Isolate | Coreidae |
| 156 | 8102145433 | Caballeronia sp. LP006 | Isolate | Coreidae |
| 157 | 8102186987 | Caballeronia sp. LZ028 | Isolate | Coreidae |
| 158 | 8102223607 | Caballeronia sp. LZ034LL | Isolate | Coreidae |
| 159 | 8102286609 | Caballeronia sp. NCTM5 | Isolate | Coreidae |
| 160 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 161 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 162 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 163 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 164 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 165 | 2528768159 | Alteromonadaceae bacterium Bs31 | Isolate | Unclassified |
| 166 | 2597489944 | Caballeronia insecticola RPE64 | Isolate | Alydidae |
| 167 | 2820152154 | Unclassified Proteobacteria Cu122P5bin47 | Isolate | Unclassified |
| 168 | 3003878002 | Paraburkholderia sp. PGU19 | Isolate | Largidae |
| 169 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 170 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 171 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 172 | 3300007139 | Ant gut microbial communities from Cephalotes pellans, Brazil | Metagenome | Formicidae |
| 173 | 3300007733 | Gill chamber microbial communities of deep-sea hydrothermal vent shrimp from South Atlantic Ocean | Metagenome | |
| 174 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 175 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 176 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 177 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 178 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 179 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 180 | 8023752828 | Caballeronia grimmiae LZ062 | Isolate | Coreidae |
| 181 | 8024019580 | Caballeronia sp. Lep1P3 | Isolate | Coreidae |
| 182 | 8024031916 | Cupriavidus pauculus BHJ32i | Isolate | Alydidae |
| 183 | 8024044713 | Caballeronia sp. Sq4a | Isolate | Coreidae |
| 184 | 8069763219 | Caballeronia sp. LZ008 | Isolate | Coreidae |
| 185 | 8100449422 | Delftia sp. S66 | Isolate | Curculionidae |
| 186 | 8102001125 | Caballeronia sp. ATUFL_F2_KS9A | Isolate | Coreidae |
| 187 | 8102169119 | Caballeronia sp. LZ016 | Isolate | Coreidae |
| 188 | 8102181083 | Caballeronia sp. LZ025 | Isolate | Coreidae |
| 189 | 8102271933 | Caballeronia sp. NCF4 | Isolate | Coreidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_006010 | 3300042659 | Bacteria | 31956 |
| 2 | Ga0160459_100087 | 3300012831 | Unclassified | 102976 |
| 3 | Ga0466657_073959 | 3300042582 | Bacteria | 4029 |
| 4 | Ga0466657_374101 | 3300042582 | Unclassified | 1005 |
| 5 | Ga0466699_383030 | 3300042597 | Bacteria | 1121 |
| 6 | CVPL005W_1000219 | 3300002934 | Bacteria | 25780 |
| 7 | Ga0102738_1000389 | 3300007141 | Bacteria | 7623 |
| 8 | Ga0105524_104511 | 3300007733 | Bacteria | 1864 |
| 9 | Ga0123357_10000032 | 3300009784 | Bacteria | 114773 |
| 10 | Ga0123357_10000237 | 3300009784 | Bacteria | 52445 |
| 11 | Ga0466710_244289 | 3300042613 | Bacteria | 14267 |
| 12 | Ga0466711_004570 | 3300042615 | Bacteria | 28597 |
| 13 | Ga0466715_004741 | 3300042616 | Bacteria | 2138 |
| 14 | Ga0466718_165272 | 3300042617 | Bacteria | 1990 |
| 15 | Ga0123354_10013287 | 3300010882 | Bacteria | 12773 |
| 16 | Ga0466697_016147 | 3300042611 | Bacteria | 1477 |
| 17 | Ga0466697_208734 | 3300042611 | Bacteria | 2325 |
| 18 | Ga0466734_044633 | 3300042623 | Bacteria | 32831 |
| 19 | Ga0466734_125925 | 3300042623 | Bacteria | 5175 |
| 20 | Ga0466725_128143 | 3300042654 | Bacteria | 1524 |
| 21 | Ga0466733_205194 | 3300042659 | Bacteria | 9389 |
| 22 | Ga0160446_103943 | 3300012835 | Unclassified | 2263 |
| 23 | Ga0466690_055909 | 3300042590 | Bacteria | 7335 |
| 24 | Ga0466693_091732 | 3300042592 | Bacteria | 1939 |
| 25 | CVPL010W_10018529 | 3300002931 | Bacteria | 8104 |
| 26 | Ga0103267_1000719 | 3300007190 | Bacteria | 22558 |
| 27 | Ga0103268_1000373 | 3300007192 | Bacteria | 14211 |
| 28 | Ga0466710_050553 | 3300042613 | Bacteria | 2201 |
| 29 | Ga0466729_171304 | 3300042621 | Bacteria | 2918 |
| 30 | Ga0123356_10663823 | 3300010049 | Bacteria | 1210 |
| 31 | Ga0123354_10029377 | 3300010882 | Bacteria | 8649 |
| 32 | Ga0466701_043885 | 3300042598 | Bacteria | 1387 |
| 33 | Ga0466701_046794 | 3300042598 | Bacteria | 11223 |
| 34 | Ga0466700_331720 | 3300042600 | Bacteria | 1899 |
| 35 | Ga0466734_129327 | 3300042623 | Bacteria | 6125 |
| 36 | Ga0466730_048744 | 3300042625 | Bacteria | 17324 |
| 37 | Ga0466702_038601 | 3300042635 | Bacteria | 5149 |
| 38 | Ga0466703_128094 | 3300042636 | Bacteria | 3957 |
| 39 | Ga0466709_259679 | 3300042648 | Bacteria | 8373 |
| 40 | Ga0466724_53791 | 3300042649 | Bacteria | 252935 |
| 41 | Ga0466708_027360 | 3300042652 | Bacteria | 17977 |
| 42 | Ga0466725_075035 | 3300042654 | Unclassified | 9241 |
| 43 | Ga0160447_103469 | 3300012849 | Bacteria | 5032 |
| 44 | Ga0160430_103720 | 3300012852 | Unclassified | 4086 |
| 45 | Ga0466657_251404 | 3300042582 | Bacteria | 1775 |
| 46 | Ga0466657_257297 | 3300042582 | Bacteria | 2676 |
| 47 | Ga0466657_280428 | 3300042582 | Bacteria | 4382 |
| 48 | JGI24696J40584_12936215 | 3300002834 | Unclassified | 1576 |
| 49 | Ga0072941_1126016 | 3300005201 | Bacteria | 6020 |
| 50 | Ga0103264_1000197 | 3300007188 | Bacteria | 38500 |
| 51 | Ga0103268_1000538 | 3300007192 | Bacteria | 11309 |
| 52 | Ga0466710_118073 | 3300042613 | Bacteria | 32374 |
| 53 | Ga0466728_427893 | 3300042620 | Bacteria | 3492 |
| 54 | Ga0123354_10000374 | 3300010882 | Bacteria | 42593 |
| 55 | Ga0466707_145704 | 3300042601 | Bacteria | 4607 |
| 56 | Ga0466719_034349 | 3300042606 | Bacteria | 7307 |
| 57 | Ga0466719_067936 | 3300042606 | Bacteria | 3647 |
| 58 | Ga0466719_288480 | 3300042606 | Bacteria | 3648 |
| 59 | Ga0466722_078699 | 3300042609 | Bacteria | 3837 |
| 60 | Ga0466708_142828 | 3300042652 | Bacteria | 17139 |
| 61 | Ga0466725_237261 | 3300042654 | Unclassified | 3734 |
| 62 | Ga0160456_101633 | 3300012820 | Bacteria | 5073 |
| 63 | Ga0160459_100482 | 3300012831 | Bacteria | 15559 |
| 64 | Ga0160460_103330 | 3300012845 | Bacteria | 2900 |
| 65 | Ga0466690_384892 | 3300042590 | Bacteria | 29462 |
| 66 | Ga0466695_101389 | 3300042595 | Bacteria | 6198 |
| 67 | JGI24702J35022_10001638 | 3300002462 | Unclassified | 13879 |
| 68 | CVPL005W_1000221 | 3300002934 | Bacteria | 27832 |
| 69 | Ga0102737_1000444 | 3300007142 | Bacteria | 13636 |
| 70 | Ga0104050_1004053 | 3300007153 | Bacteria | 3751 |
| 71 | Ga0466715_490816 | 3300042616 | Bacteria | 8932 |
| 72 | Ga0123356_10710454 | 3300010049 | Bacteria | 1174 |
| 73 | Ga0466716_212395 | 3300042605 | Bacteria | 1838 |
| 74 | Ga0466719_087637 | 3300042606 | Bacteria | 18430 |
| 75 | Ga0466734_014583 | 3300042623 | Bacteria | 2568 |
| 76 | Ga0466734_077204 | 3300042623 | Bacteria | 6453 |
| 77 | Ga0466704_258426 | 3300042643 | Bacteria | 95131 |
| 78 | Ga0466725_070285 | 3300042654 | Bacteria | 5003 |
| 79 | Ga0466725_221672 | 3300042654 | Bacteria | 17271 |
| 80 | Ga0466727_312045 | 3300042655 | Bacteria | 91345 |
| 81 | Ga0160470_102963 | 3300012813 | Unclassified | 2928 |
| 82 | Ga0160436_1013566 | 3300012861 | Unclassified | 1696 |
| 83 | Ga0466701_014839 | 3300042598 | Bacteria | 13676 |
| 84 | JGI24702J35022_10201124 | 3300002462 | Bacteria | 1140 |
| 85 | CVPL010W_10005960 | 3300002931 | Bacteria | 12756 |
| 86 | Ga0068302_10005836 | 3300005071 | Bacteria | 8225 |
| 87 | Ga0072941_1060739 | 3300005201 | Bacteria | 13051 |
| 88 | Ga0072941_1368139 | 3300005201 | Bacteria | 2156 |
| 89 | Ga0103265_1000822 | 3300007068 | Bacteria | 5169 |
| 90 | Ga0102735_1000363 | 3300007080 | Bacteria | 10120 |
| 91 | Ga0103268_1005977 | 3300007192 | Bacteria | 2467 |
| 92 | Ga0466710_244896 | 3300042613 | Bacteria | 5667 |
| 93 | Ga0466710_361536 | 3300042613 | Bacteria | 65742 |
| 94 | Ga0466715_405933 | 3300042616 | Bacteria | 6240 |
| 95 | Ga0466723_030956 | 3300042618 | Bacteria | 22854 |
| 96 | Ga0466701_022011 | 3300042598 | Bacteria | 293822 |
| 97 | Ga0466701_047531 | 3300042598 | Bacteria | 58092 |
| 98 | Ga0466735_052711 | 3300042624 | Bacteria | 1018 |
| 99 | Ga0466703_083492 | 3300042636 | Bacteria | 13754 |
| 100 | Ga0466708_405933 | 3300042652 | Bacteria | 43361 |
| 101 | Ga0466725_193092 | 3300042654 | Bacteria | 188399 |
| 102 | Ga0160470_103197 | 3300012813 | Unclassified | 2716 |
| 103 | Ga0160452_100151 | 3300012834 | Bacteria | 81696 |
| 104 | Ga0160472_101011 | 3300012839 | Bacteria | 10087 |
| 105 | Ga0160447_107613 | 3300012849 | Bacteria | 2687 |
| 106 | Ga0466656_092263 | 3300042550 | Bacteria | 1622 |
| 107 | Ga0466657_378630 | 3300042582 | Bacteria | 5037 |
| 108 | CVPL010W_10003800 | 3300002931 | Bacteria | 17152 |
| 109 | Ga0068305_10081797 | 3300005083 | Bacteria | 4816 |
| 110 | Ga0102736_1000387 | 3300007052 | Bacteria | 12461 |
| 111 | Ga0123353_10252441 | 3300010167 | Bacteria | 2730 |
| 112 | Ga0160471_102847 | 3300012812 | Bacteria | 2758 |
| 113 | Ga0466701_021367 | 3300042598 | Bacteria | 7743 |
| 114 | Ga0466707_314669 | 3300042601 | Bacteria | 3667 |
| 115 | Ga0466717_042457 | 3300042604 | Bacteria | 6340 |
| 116 | Ga0466697_185429 | 3300042611 | Bacteria | 2534 |
| 117 | Ga0466730_060188 | 3300042625 | Bacteria | 807184 |
| 118 | Ga0466730_092809 | 3300042625 | Bacteria | 164860 |
| 119 | Ga0466703_098848 | 3300042636 | Bacteria | 35286 |
| 120 | Ga0466724_23079 | 3300042649 | Bacteria | 108720 |
| 121 | Ga0466724_53313 | 3300042649 | Bacteria | 7909 |
| 122 | Ga0466708_211386 | 3300042652 | Bacteria | 11155 |
| 123 | Ga0160460_100865 | 3300012845 | Bacteria | 13201 |
| 124 | Ga0466657_106717 | 3300042582 | Bacteria | 15889 |
| 125 | Ga0466692_112515 | 3300042591 | Bacteria | 34783 |
| 126 | Ga0466691_067007 | 3300042593 | Bacteria | 9418 |
| 127 | IMNBGM34_c000040 | 3300000036 | Bacteria | 36196 |
| 128 | CVPL010W_10009583 | 3300002931 | Bacteria | 14780 |
| 129 | Ga0103266_1000947 | 3300007067 | Bacteria | 8986 |
| 130 | Ga0102734_1000428 | 3300007129 | Unclassified | 12104 |
| 131 | Ga0103260_1000688 | 3300007139 | Bacteria | 6392 |
| 132 | Ga0102738_1000102 | 3300007141 | Bacteria | 29692 |
| 133 | Ga0102737_1000440 | 3300007142 | Bacteria | 13699 |
| 134 | Ga0466713_113603 | 3300042602 | Bacteria | 6492 |
| 135 | Ga0466697_165727 | 3300042611 | Bacteria | 1410 |
| 136 | Ga0466705_087780 | 3300042612 | Bacteria | 84355 |
| 137 | Ga0466734_059668 | 3300042623 | Unclassified | 3847 |
| 138 | Ga0466725_220958 | 3300042654 | Bacteria | 3526 |
| 139 | Ga0160441_100117 | 3300012825 | Bacteria | 90941 |
| 140 | Ga0466657_400254 | 3300042582 | Bacteria | 44386 |
| 141 | Ga0466690_252595 | 3300042590 | Bacteria | 114158 |
| 142 | Ga0466695_178193 | 3300042595 | Bacteria | 6924 |
| 143 | Ga0103263_102271 | 3300007042 | Unclassified | 2390 |
| 144 | Ga0103266_1000032 | 3300007067 | Bacteria | 64254 |
| 145 | Ga0103264_1000593 | 3300007188 | Bacteria | 17595 |
| 146 | Ga0103264_1001882 | 3300007188 | Bacteria | 9320 |
| 147 | Ga0466710_094155 | 3300042613 | Bacteria | 2600 |
| 148 | Ga0466710_209788 | 3300042613 | Bacteria | 1701 |
| 149 | Ga0466729_015267 | 3300042621 | Bacteria | 27681 |
| 150 | Ga0123354_10083957 | 3300010882 | Bacteria | 4476 |
| 151 | Ga0466717_188118 | 3300042604 | Bacteria | 5072 |
| 152 | Ga0466697_221683 | 3300042611 | Bacteria | 1184 |
| 153 | Ga0466708_451883 | 3300042652 | Bacteria | 3701 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00977 | His_biosynth | Histidine biosynthesis protein | 40 | 269 | 0.99 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF00977 | GO:0000105 | L-histidine biosynthetic process | BP |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.