Protein Family IF04335
Metagenome
Metatranscriptome
Isolate
141
Members
59
Samples
116
Scaffolds
161.06
Avg Length
Representative Sequence
- ID
- 3300038395|Ga0415639_184977|Ga0415639_184977_714_1244
- Length
- 176 aa
- Sequence
- VGKKPFCDKSTPERKFVEMNISVGISDWKIAKPPDSLITYALGSCVGIAIFDKARKIAGLSHIMLPESKNAAEGATNRMKFADTAIPDMLNQMLSMGAGRVGLQAKIAGGAVMFKVGTDRFNIGERNIAAVKTALQALRIPIIGQDTGKDYGRTMILDPGDGMVVIKSANRGEWRL
Sample Types
Isolate
17.7%
Metagenome
81.6%
MAG
0.0%
Metatranscriptome
0.7%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
41.4%
Unclassified
41.4%
Kalotermitidae
8.6%
Termopsidae
3.4%
Stratiomyidae
1.7%
Scarabaeidae
1.7%
Rhinotermitidae
1.7%
Taxonomy
Archaea
3
Bacteria
122
Eukaryota
0
Viruses
0
Unclassified
16
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2590828839 | Clostridium sp. 1 | Isolate | Termitidae |
| 2 | 2820254385 | Unclassified Firmicutes Th196P3bin54 | Isolate | Unclassified |
| 3 | 2820339298 | Unclassified Firmicutes Nt197P3bin68 | Isolate | Unclassified |
| 4 | 2772190993 | Unclassified Euryarchaeota Lab288P4bin101 | Isolate | Unclassified |
| 5 | 8030337018 | Tissierella sp. Yu-01 | Isolate | Stratiomyidae |
| 6 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 7 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 8 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 9 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 10 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 11 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 12 | 2820357977 | Unclassified Firmicutes Nt197P3bin136 | Isolate | Unclassified |
| 13 | 2820373881 | Unclassified Firmicutes Nt197P3bin10 | Isolate | Unclassified |
| 14 | 2820463629 | Unclassified Firmicutes Lab288P3bin124 | Isolate | Unclassified |
| 15 | 2820483401 | Unclassified Firmicutes Lab288P1bin74 | Isolate | Unclassified |
| 16 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 17 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 18 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 19 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 20 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 21 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 22 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 23 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 24 | 2820570671 | Unclassified Firmicutes Emb289P3bin19 | Isolate | Unclassified |
| 25 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 26 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 27 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 28 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 29 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 30 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 31 | 2529293168 | Ruminiclostridium cellobioparum termitidis CT1112 | Isolate | Termitidae |
| 32 | 2634166424 | Clostridium sp. L74 | Isolate | Scarabaeidae |
| 33 | 2820453354 | Unclassified Firmicutes Lab288P3bin172 | Isolate | Unclassified |
| 34 | 2820560510 | Unclassified Firmicutes Emb289P3bin72 | Isolate | Unclassified |
| 35 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 36 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 37 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 38 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 39 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 40 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 41 | 2820223845 | Unclassified Firmicutes Th196P4bin57 | Isolate | Unclassified |
| 42 | 2820259584 | Unclassified Firmicutes Th196P3bin43 | Isolate | Unclassified |
| 43 | 2820265624 | Unclassified Firmicutes Th196P3bin36 | Isolate | Unclassified |
| 44 | 2820288918 | Unclassified Firmicutes Th196P3bin137 | Isolate | Unclassified |
| 45 | 2820294436 | Unclassified Firmicutes Th196P3bin104 | Isolate | Unclassified |
| 46 | 2820321184 | Unclassified Firmicutes Nt197P3bin86 | Isolate | Unclassified |
| 47 | 2820387566 | Unclassified Firmicutes Nt197P1bin1 | Isolate | Unclassified |
| 48 | 2820569216 | Unclassified Firmicutes Emb289P3bin33 | Isolate | Unclassified |
| 49 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 50 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 51 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 52 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 53 | 3300021244 | Termite gut microbial communities from nest from French Guiana - 12-6 mRNA SA | Metatranscriptome | Termitidae |
| 54 | 2820255904 | Unclassified Firmicutes Th196P3bin48 | Isolate | Unclassified |
| 55 | 2820319488 | Unclassified Firmicutes Nt197P3bin88 | Isolate | Unclassified |
| 56 | 2820360414 | Unclassified Firmicutes Nt197P3bin121 | Isolate | Unclassified |
| 57 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 58 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 59 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466700_434888 | 3300042600 | Bacteria | 1514 |
| 2 | Ga0466707_303887 | 3300042601 | Bacteria | 8027 |
| 3 | Ga0466697_036465 | 3300042611 | Bacteria | 1052 |
| 4 | Ga0123357_10045427 | 3300009784 | Bacteria | 5959 |
| 5 | Ga0123353_10115701 | 3300010167 | Unclassified | 4316 |
| 6 | Ga0123353_10364591 | 3300010167 | Bacteria | 2169 |
| 7 | Ga0123353_10404791 | 3300010167 | Bacteria | 2029 |
| 8 | Ga0123353_10722614 | 3300010167 | Bacteria | 1393 |
| 9 | Ga0123354_10017163 | 3300010882 | Bacteria | 11337 |
| 10 | Ga0123354_10146270 | 3300010882 | Unclassified | 2891 |
| 11 | Ga0466702_265012 | 3300042635 | Bacteria | 98723 |
| 12 | Ga0415639_041830 | 3300038395 | Bacteria | 3190 |
| 13 | Ga0415639_196625 | 3300038395 | Bacteria | 2326 |
| 14 | Ga0072941_1353530 | 3300005201 | Bacteria | 3966 |
| 15 | Ga0466707_203280 | 3300042601 | Bacteria | 20397 |
| 16 | Ga0466716_225011 | 3300042605 | Bacteria | 1547 |
| 17 | Ga0123356_10105265 | 3300010049 | Bacteria | 2714 |
| 18 | Ga0123356_12838371 | 3300010049 | Bacteria | 606 |
| 19 | Ga0123353_10133420 | 3300010167 | Bacteria | 3984 |
| 20 | Ga0466702_175356 | 3300042635 | Bacteria | 3103 |
| 21 | Ga0466710_113886 | 3300042613 | Bacteria | 3834 |
| 22 | Ga0415639_035241 | 3300038395 | Bacteria | 1392 |
| 23 | Ga0466707_017088 | 3300042601 | Bacteria | 60022 |
| 24 | Ga0466697_027524 | 3300042611 | Bacteria | 1068 |
| 25 | Ga0123356_10000021 | 3300010049 | Bacteria | 176996 |
| 26 | Ga0123356_10015983 | 3300010049 | Unclassified | 7175 |
| 27 | Ga0123356_10126824 | 3300010049 | Bacteria | 2493 |
| 28 | Ga0123353_10298742 | 3300010167 | Bacteria | 2460 |
| 29 | Ga0123353_10628993 | 3300010167 | Bacteria | 1525 |
| 30 | Ga0123354_10403775 | 3300010882 | Bacteria | 1154 |
| 31 | Ga0415639_003286 | 3300038395 | Bacteria | 56769 |
| 32 | Ga0415639_003489 | 3300038395 | Bacteria | 30262 |
| 33 | Ga0415639_018133 | 3300038395 | Bacteria | 9628 |
| 34 | Ga0415639_045055 | 3300038395 | Bacteria | 2475 |
| 35 | Ga0415639_050555 | 3300038395 | Unclassified | 2850 |
| 36 | Ga0466656_197946 | 3300042550 | Bacteria | 6095 |
| 37 | Ga0466694_228903 | 3300042594 | Bacteria | 1012 |
| 38 | Ga0466700_198316 | 3300042600 | Bacteria | 2795 |
| 39 | Ga0466707_345298 | 3300042601 | Bacteria | 1803 |
| 40 | Ga0466721_226592 | 3300042608 | Bacteria | 1265 |
| 41 | Ga0466698_206383 | 3300042610 | Bacteria | 4188 |
| 42 | Ga0123356_12449613 | 3300010049 | Unclassified | 653 |
| 43 | Ga0123353_10124067 | 3300010167 | Bacteria | 4151 |
| 44 | Ga0123353_10183601 | 3300010167 | Bacteria | 3309 |
| 45 | Ga0123353_10627189 | 3300010167 | Bacteria | 1528 |
| 46 | Ga0466726_019809 | 3300042619 | Unclassified | 9605 |
| 47 | Ga0415639_004796 | 3300038395 | Bacteria | 40400 |
| 48 | Ga0415639_062535 | 3300038395 | Unclassified | 2704 |
| 49 | JGI24702J35022_10001273 | 3300002462 | Bacteria | 15707 |
| 50 | JGI24703J35330_11748815 | 3300002501 | Bacteria | 40125 |
| 51 | Ga0072940_1070373 | 3300005200 | Bacteria | 3200 |
| 52 | Ga0466705_161942 | 3300042612 | Bacteria | 8163 |
| 53 | Ga0466721_019570 | 3300042608 | Bacteria | 1841 |
| 54 | Ga0466721_160537 | 3300042608 | Bacteria | 71411 |
| 55 | Ga0123356_10009583 | 3300010049 | Bacteria | 9557 |
| 56 | Ga0123356_10010408 | 3300010049 | Bacteria | 9127 |
| 57 | Ga0123356_10012959 | 3300010049 | Bacteria | 8068 |
| 58 | Ga0123356_10273631 | 3300010049 | Unclassified | 1780 |
| 59 | Ga0123356_10411843 | 3300010049 | Unclassified | 1491 |
| 60 | Ga0123353_10000210 | 3300010167 | Bacteria | 74209 |
| 61 | Ga0123353_10102010 | 3300010167 | Bacteria | 4625 |
| 62 | Ga0123353_10815980 | 3300010167 | Bacteria | 1285 |
| 63 | Ga0123353_11799547 | 3300010167 | Bacteria | 761 |
| 64 | Ga0466711_513364 | 3300042615 | Bacteria | 4155 |
| 65 | Ga0223686_1015687 | 3300021244 | Bacteria | 1277 |
| 66 | Ga0415639_024083 | 3300038395 | Bacteria | 1231 |
| 67 | Ga0415639_059392 | 3300038395 | Bacteria | 2825 |
| 68 | Ga0415639_074066 | 3300038395 | Bacteria | 7219 |
| 69 | Ga0466657_007744 | 3300042582 | Archaea | 1544 |
| 70 | Ga0068302_10569952 | 3300005071 | Bacteria | 1769 |
| 71 | Ga0466733_069641 | 3300042659 | Bacteria | 1197 |
| 72 | Ga0123357_10004915 | 3300009784 | Bacteria | 15859 |
| 73 | Ga0123353_10177406 | 3300010167 | Unclassified | 3377 |
| 74 | Ga0123353_10195855 | 3300010167 | Bacteria | 3185 |
| 75 | Ga0123353_10506256 | 3300010167 | Unclassified | 1757 |
| 76 | Ga0123353_12063071 | 3300010167 | Bacteria | 696 |
| 77 | Ga0466729_255148 | 3300042621 | Bacteria | 5937 |
| 78 | Ga0466704_027112 | 3300042643 | Bacteria | 3779 |
| 79 | Ga0415639_003747 | 3300038395 | Bacteria | 47783 |
| 80 | Ga0415639_045054 | 3300038395 | Unclassified | 1123 |
| 81 | Ga0415639_050026 | 3300038395 | Bacteria | 8668 |
| 82 | AustNasuHG_c1000009 | 3300000089 | Bacteria | 54182 |
| 83 | JGI24705J35276_12197495 | 3300002504 | Bacteria | 1556 |
| 84 | Ga0072940_1008164 | 3300005200 | Bacteria | 9141 |
| 85 | Ga0466733_140631 | 3300042659 | Bacteria | 1976 |
| 86 | Ga0466713_014582 | 3300042602 | Unclassified | 1681 |
| 87 | Ga0466714_073203 | 3300042603 | Bacteria | 47226 |
| 88 | Ga0466721_293515 | 3300042608 | Bacteria | 13319 |
| 89 | Ga0123356_10000312 | 3300010049 | Bacteria | 55710 |
| 90 | Ga0123356_10003981 | 3300010049 | Bacteria | 15352 |
| 91 | Ga0123356_10043871 | 3300010049 | Bacteria | 4164 |
| 92 | Ga0123353_10008737 | 3300010167 | Bacteria | 13877 |
| 93 | Ga0123353_10080224 | 3300010167 | Bacteria | 5248 |
| 94 | Ga0123353_10091873 | 3300010167 | Bacteria | 4888 |
| 95 | Ga0123353_10327830 | 3300010167 | Bacteria | 2320 |
| 96 | Ga0123353_11134742 | 3300010167 | Bacteria | 1034 |
| 97 | Ga0415639_001826 | 3300038395 | Bacteria | 43745 |
| 98 | Ga0415639_005306 | 3300038395 | Bacteria | 40315 |
| 99 | Ga0415639_027641 | 3300038395 | Bacteria | 3238 |
| 100 | Ga0415639_074067 | 3300038395 | Bacteria | 2746 |
| 101 | Ga0415639_184977 | 3300038395 | Bacteria | 1972 |
| 102 | Ga0068305_10527774 | 3300005083 | Unclassified | 583 |
| 103 | Ga0072940_1042068 | 3300005200 | Bacteria | 2043 |
| 104 | Ga0466721_097087 | 3300042608 | Bacteria | 3530 |
| 105 | Ga0123356_10002462 | 3300010049 | Bacteria | 19766 |
| 106 | Ga0123356_11836439 | 3300010049 | Bacteria | 754 |
| 107 | Ga0123353_10014710 | 3300010167 | Bacteria | 11303 |
| 108 | Ga0123353_10054164 | 3300010167 | Bacteria | 6414 |
| 109 | Ga0123353_10112281 | 3300010167 | Bacteria | 4388 |
| 110 | Ga0123353_10861400 | 3300010167 | Archaea | 1240 |
| 111 | Ga0466703_323894 | 3300042636 | Bacteria | 11784 |
| 112 | Ga0466710_063937 | 3300042613 | Unclassified | 1066 |
| 113 | Ga0415639_017468 | 3300038395 | Bacteria | 3128 |
| 114 | JGI24702J35022_10018978 | 3300002462 | Bacteria | 3745 |
| 115 | Ga0072940_1045850 | 3300005200 | Bacteria | 14263 |
| 116 | Ga0072940_1592123 | 3300005200 | Unclassified | 574 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF03975 | CheD | CheD chemotactic sensory transduction | 64 | 168 | 0.94 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.