Protein Family IF04304

Metagenome Isolate
125 Members
43 Samples
119 Scaffolds
298.62 Avg Length

🧬 Representative Sequence

ID
3300038395|Ga0415639_044797|Ga0415639_044797_3088_4065
Length
325 aa
Sequence
MPKIQYKRIDIRAAGRTLIKQVNAIIEQYADLGYSLTLRQVYYQMVARDIIPNNMNSYNMLGDYIANGRLAGLIDWYAIEDRTRSLRRLSHWRNPGEIVEGAVRSYQRDLWETQPKYVEVWVEKDALIGIVQQVANRFDVPCFSCRGYTSTTEMWYAGQRLMSKSNDGERPVKIIHLGDHDPSGIDMTRDIEDRINLFTSHNADQDSPSGLEFTIDRIALNMDQIKEFNPPTNPAKNTDSRFKMYFAKFGQHCWELDAIEPTKLDNLISAHIVANMDEKLMKKAKKRMEKERKSLKTAVDFVQNPEDWQKKITLGPEMGYYGGLL

📊 Sample Types

Isolate 0.8%
Metagenome 99.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 51.2%
Kalotermitidae 31.7%
Unclassified 7.3%
Rhinotermitidae 4.9%
Hodotermitidae 2.4%
Termopsidae 2.4%

🌳 Taxonomy

Archaea 4
Bacteria 82
Eukaryota 0
Viruses 1
Unclassified 38

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
2 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
3 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
4 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
5 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
6 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
7 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
8 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
9 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
10 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
11 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
12 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
13 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
14 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
15 2773857682 Unclassified Methanosarcinaceae Lab288P3bin112 Isolate Unclassified
16 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
17 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
18 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
19 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
20 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
21 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
22 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
23 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
24 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
25 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
26 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
27 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
28 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
29 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
30 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
31 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
32 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
33 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
34 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
35 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
36 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
37 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
38 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
39 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
40 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
41 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
42 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
43 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_228992 3300042612 Unclassified 3036
2 Ga0466707_090604 3300042601 Bacteria 2383
3 Ga0466707_181727 3300042601 Bacteria 103366
4 Ga0415639_020129 3300038395 Unclassified 3383
5 Ga0415639_260325 3300038395 Unclassified 1180
6 Ga0466691_216381 3300042593 Bacteria 11792
7 Ga0466705_502895 3300042612 Bacteria 6787
8 Ga0466711_234494 3300042615 Bacteria 4056
9 Ga0466728_203796 3300042620 Unclassified 1578
10 Ga0123357_10091082 3300009784 Bacteria 3974
11 Ga0123356_10010959 3300010049 Bacteria 8855
12 JGI24698J34947_10000477 3300002449 Bacteria 18782
13 Ga0466709_124872 3300042648 Bacteria 5486
14 Ga0466708_454758 3300042652 Bacteria 15040
15 Ga0466705_163721 3300042612 Bacteria 24107
16 Ga0466705_186914 3300042612 Unclassified 1323
17 Ga0466706_076143 3300042599 Bacteria 4304
18 Ga0466722_207323 3300042609 Bacteria 6674
19 Ga0415639_129006 3300038395 Bacteria 5571
20 Ga0466712_046694 3300042614 Bacteria 3773
21 Ga0466711_137509 3300042615 Bacteria 8149
22 Ga0466711_158715 3300042615 Bacteria 1683
23 Ga0466715_043086 3300042616 Bacteria 3731
24 Ga0072941_1004546 3300005201 Bacteria 68753
25 Ga0466703_205052 3300042636 Bacteria 2165
26 Ga0466709_018804 3300042648 Bacteria 36444
27 Ga0466709_034599 3300042648 Bacteria 2149
28 Ga0466709_066047 3300042648 Bacteria 3371
29 Ga0466713_084316 3300042602 Bacteria 4930
30 Ga0264413_109358 3300024493 Unclassified 9071
31 Ga0466690_211082 3300042590 Bacteria 4216
32 Ga0466694_210482 3300042594 Unclassified 1990
33 Ga0466705_523129 3300042612 Bacteria 26854
34 Ga0466711_086703 3300042615 Bacteria 2492
35 Ga0466726_195393 3300042619 Unclassified 2164
36 Ga0123354_10213320 3300010882 Bacteria 2078
37 JGI24698J34947_10000631 3300002449 Bacteria 16961
38 Ga0072941_1271494 3300005201 Unclassified 2133
39 Ga0466703_085372 3300042636 Bacteria 23165
40 Ga0466703_131678 3300042636 Unclassified 1012
41 Ga0466708_208103 3300042652 Unclassified 3005
42 Ga0466700_409017 3300042600 Unclassified 1354
43 Ga0466720_156846 3300042607 Bacteria 86259
44 Ga0466721_175307 3300042608 Unclassified 1205
45 Ga0466691_033511 3300042593 Bacteria 3572
46 Ga0466705_514495 3300042612 Bacteria 12409
47 Ga0466723_304226 3300042618 Bacteria 1110
48 Ga0466723_317454 3300042618 Bacteria 10732
49 Ga0466726_209215 3300042619 Bacteria 3793
50 Ga0466726_424956 3300042619 Unclassified 2085
51 Ga0466726_457487 3300042619 Unclassified 3850
52 Ga0466729_051506 3300042621 Bacteria 3195
53 Ga0123356_10029810 3300010049 Bacteria 5107
54 JGI24698J34947_10025391 3300002449 Bacteria 3154
55 Ga0466703_242909 3300042636 Bacteria 20475
56 Ga0466704_147488 3300042643 Unclassified 1698
57 Ga0466709_258110 3300042648 Bacteria 7750
58 Ga0466708_193293 3300042652 Unclassified 2049
59 Ga0466708_360138 3300042652 Unclassified 2848
60 Ga0466717_021082 3300042604 Bacteria 2436
61 Ga0466719_025284 3300042606 Archaea 1786
62 Ga0466698_432996 3300042610 Unclassified 2181
63 Ga0415639_044797 3300038395 Bacteria 12100
64 Ga0466657_259990 3300042582 Archaea 19011
65 Ga0466712_254819 3300042614 Bacteria 4698
66 Ga0466723_184688 3300042618 Bacteria 14168
67 Ga0466728_230451 3300042620 Unclassified 3182
68 AustNasuHG_c1033169 3300000089 Bacteria 1412
69 JGI24702J35022_10001331 3300002462 Bacteria 15354
70 Ga0072941_1021556 3300005201 Bacteria 3977
71 Ga0466708_242110 3300042652 Bacteria 1939
72 Ga0466719_153948 3300042606 Bacteria 7124
73 Ga0466720_036231 3300042607 Bacteria 4587
74 Ga0264413_119907 3300024493 Bacteria 10673
75 Ga0415639_270983 3300038395 Bacteria 1545
76 Ga0466696_412715 3300042596 Unclassified 1524
77 Ga0466696_482387 3300042596 Bacteria 4252
78 Ga0466705_499984 3300042612 Bacteria 70450
79 Ga0466711_418512 3300042615 Bacteria 21773
80 Ga0466715_459022 3300042616 Bacteria 2114
81 Ga0466728_050002 3300042620 Unclassified 2483
82 Ga0123353_10003226 3300010167 Bacteria 20547
83 JGI24705J35276_12234640 3300002504 Unclassified 5693
84 Ga0072941_1005555 3300005201 Bacteria 10393
85 Ga0072941_1607818 3300005201 Unclassified 1608
86 Ga0466703_275752 3300042636 Bacteria 3032
87 Ga0466708_358871 3300042652 Bacteria 12724
88 Ga0466732_000869 3300042656 Unclassified 1301
89 Ga0264413_126061 3300024493 Bacteria 11750
90 Ga0466690_026586 3300042590 Unclassified 1587
91 Ga0466691_069949 3300042593 Bacteria 10670
92 Ga0466694_129768 3300042594 Bacteria 1825
93 Ga0466723_021947 3300042618 Unclassified 2066
94 Ga0466728_258536 3300042620 Bacteria 26593
95 Ga0123353_10000255 3300010167 Archaea 67198
96 Ga0123353_10454782 3300010167 Unclassified 1884
97 JGI24702J35022_10007877 3300002462 Bacteria 6064
98 Ga0466704_233262 3300042643 Unclassified 25073
99 Ga0466707_227802 3300042601 Bacteria 1450
100 Ga0466690_424691 3300042590 Bacteria 13632
101 Ga0466694_075399 3300042594 Bacteria 1963
102 Ga0466694_076990 3300042594 Viruses 1110
103 Ga0466699_182935 3300042597 Bacteria 5057
104 Ga0466705_412840 3300042612 Bacteria 10701
105 Ga0466705_432612 3300042612 Bacteria 2085
106 Ga0466712_075563 3300042614 Bacteria 21393
107 Ga0466718_036861 3300042617 Unclassified 2373
108 Ga0466718_079412 3300042617 Unclassified 2375
109 Ga0466728_187978 3300042620 Bacteria 10045
110 Ga0466728_196541 3300042620 Bacteria 3788
111 Ga0466728_325409 3300042620 Bacteria 1703
112 Ga0123353_10765466 3300010167 Unclassified 1341
113 JGI24695J34938_10009295 3300002450 Bacteria 5479
114 Ga0072941_1169268 3300005201 Bacteria 5540
115 Ga0466703_227232 3300042636 Bacteria 1970
116 Ga0466703_365554 3300042636 Bacteria 7925
117 Ga0466704_038281 3300042643 Bacteria 1343
118 Ga0466704_220900 3300042643 Bacteria 15289
119 Ga0466708_015736 3300042652 Unclassified 17076

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042643 Ga0466704_147488 Ga0466704_147488_211_936 241
2 3300042615 Ga0466711_158715 Ga0466711_158715_294_1073 259
3 3300042620 Ga0466728_050002 Ga0466728_050002_897_1688 263
4 3300042652 Ga0466708_193293 Ga0466708_193293_1187_1996 263
5 3300042636 Ga0466703_242909 Ga0466703_242909_13439_14323 272
6 3300005201 Ga0072941_1005555 Ga0072941_10055553 276
7 3300038395 Ga0415639_270983 Ga0415639_270983_337_1197 276
8 3300042594 Ga0466694_210482 Ga0466694_210482_313_1146 277
9 3300002449 JGI24698J34947_10000477 JGI24698J34947_1000047711 278
10 3300042620 Ga0466728_325409 Ga0466728_325409_642_1508 279
11 3300042600 Ga0466700_409017 Ga0466700_409017_375_1226 283
12 3300042594 Ga0466694_129768 Ga0466694_129768_603_1472 284
13 3300042618 Ga0466723_317454 Ga0466723_317454_4509_5387 284
14 3300042590 Ga0466690_211082 Ga0466690_211082_2710_3585 285
15 3300042601 Ga0466707_181727 Ga0466707_181727_12014_12928 285
16 3300042619 Ga0466726_195393 Ga0466726_195393_447_1304 285
17 3300042590 Ga0466690_026586 Ga0466690_026586_298_1161 287
18 3300010167 Ga0123353_10765466 Ga0123353_107654661 288
19 3300038395 Ga0415639_260325 Ga0415639_260325_252_1118 288
20 3300042593 Ga0466691_216381 Ga0466691_216381_243_1109 288
21 3300042610 Ga0466698_432996 Ga0466698_432996_213_1079 288
22 3300042615 Ga0466711_137509 Ga0466711_137509_3968_4834 288
23 3300042616 Ga0466715_043086 Ga0466715_043086_2404_3270 288
24 3300042643 Ga0466704_038281 Ga0466704_038281_101_967 288
25 3300042648 Ga0466709_124872 Ga0466709_124872_4582_5448 288
26 3300042652 Ga0466708_015736 Ga0466708_015736_10775_11641 288
27 3300024493 Ga0264413_119907 Ga0264413_1199077 289
28 3300038395 Ga0415639_020129 Ga0415639_020129_2230_3099 289
29 3300042601 Ga0466707_227802 Ga0466707_227802_477_1346 289
30 3300042602 Ga0466713_084316 Ga0466713_084316_918_1787 289
31 3300042619 Ga0466726_424956 Ga0466726_424956_706_1623 289
32 3300042643 Ga0466704_220900 Ga0466704_220900_6609_7478 289
33 3300042597 Ga0466699_182935 Ga0466699_182935_413_1285 290
34 3300042619 Ga0466726_209215 Ga0466726_209215_2428_3345 290
35 3300042619 Ga0466726_457487 Ga0466726_457487_1867_2739 290
36 3300002449 JGI24698J34947_10000631 JGI24698J34947_100006316 291
37 3300038395 Ga0415639_129006 Ga0415639_129006_3589_4464 291
38 3300042604 Ga0466717_021082 Ga0466717_021082_486_1361 291
39 3300042614 Ga0466712_075563 Ga0466712_075563_18927_19835 291
40 3300010049 Ga0123356_10029810 Ga0123356_100298108 292
41 3300010882 Ga0123354_10213320 Ga0123354_102133204 292
42 3300042612 Ga0466705_432612 Ga0466705_432612_510_1388 292
43 3300042614 Ga0466712_254819 Ga0466712_254819_1016_1894 292
44 3300042593 Ga0466691_069949 Ga0466691_069949_3613_4551 293
45 3300042612 Ga0466705_163721 Ga0466705_163721_22577_23500 293
46 3300042615 Ga0466711_086703 Ga0466711_086703_1124_2005 293
47 3300042615 Ga0466711_234494 Ga0466711_234494_1104_2024 293
48 3300042620 Ga0466728_203796 Ga0466728_203796_309_1262 293
49 3300042607 Ga0466720_036231 Ga0466720_036231_1904_2788 294
50 3300042616 Ga0466715_459022 Ga0466715_459022_262_1149 295
51 3300042652 Ga0466708_454758 Ga0466708_454758_8755_9642 295
52 3300010167 Ga0123353_10000255 Ga0123353_1000025518 296
53 3300024493 Ga0264413_109358 Ga0264413_1093589 296
54 3300042594 Ga0466694_075399 Ga0466694_075399_56_946 296
55 3300042636 Ga0466703_205052 Ga0466703_205052_500_1444 296
56 3300010167 Ga0123353_10454782 Ga0123353_104547822 297
57 3300042590 Ga0466690_424691 Ga0466690_424691_8082_8975 297
58 3300042594 Ga0466694_076990 Ga0466694_076990_114_1007 297
59 3300042617 Ga0466718_036861 Ga0466718_036861_18_911 297
60 3300042617 Ga0466718_079412 Ga0466718_079412_18_911 297
61 3300042643 Ga0466704_233262 Ga0466704_233262_8770_9723 297
62 iso_pu_archaea 2773857682 2774154437 297
63 3300002462 JGI24702J35022_10007877 JGI24702J35022_100078773 298
64 3300042582 Ga0466657_259990 Ga0466657_259990_3768_4664 298
65 3300042621 Ga0466729_051506 Ga0466729_051506_369_1265 298
66 3300042606 Ga0466719_025284 Ga0466719_025284_721_1620 299
67 3300042648 Ga0466709_018804 Ga0466709_018804_12917_13816 299
68 3300002462 JGI24702J35022_10001331 JGI24702J35022_100013316 300
69 3300042652 Ga0466708_242110 Ga0466708_242110_1026_1928 300
70 3300042612 Ga0466705_186914 Ga0466705_186914_11_916 301
71 3300010167 Ga0123353_10003226 Ga0123353_1000322612 302
72 3300042596 Ga0466696_412715 Ga0466696_412715_358_1266 302
73 3300042618 Ga0466723_304226 Ga0466723_304226_144_1076 302
74 3300042636 Ga0466703_275752 Ga0466703_275752_529_1437 302
75 3300042636 Ga0466703_275752 Ga0466703_275752_529_1437 302
76 3300005201 Ga0072941_1607818 Ga0072941_16078182 303
77 3300042593 Ga0466691_033511 Ga0466691_033511_787_1698 303
78 3300042607 Ga0466720_156846 Ga0466720_156846_33640_34551 303
79 3300042612 Ga0466705_412840 Ga0466705_412840_4014_4925 303
80 3300042614 Ga0466712_046694 Ga0466712_046694_39_950 303
81 3300002450 JGI24695J34938_10009295 JGI24695J34938_100092952 304
82 3300002504 JGI24705J35276_12234640 JGI24705J35276_122346406 304
83 3300005201 Ga0072941_1004546 Ga0072941_100454689 304
84 3300005201 Ga0072941_1271494 Ga0072941_12714943 304
85 3300042620 Ga0466728_258536 Ga0466728_258536_12224_13141 305
86 3300002449 JGI24698J34947_10025391 JGI24698J34947_100253911 306
87 3300005201 Ga0072941_1169268 Ga0072941_11692688 306
88 3300042636 Ga0466703_085372 Ga0466703_085372_8987_9907 306
89 3300042620 Ga0466728_230451 Ga0466728_230451_1557_2510 307
90 3300024493 Ga0264413_126061 Ga0264413_12606115 308
91 3300042599 Ga0466706_076143 Ga0466706_076143_2494_3420 308
92 3300042612 Ga0466705_499984 Ga0466705_499984_4774_5700 308
93 3300042618 Ga0466723_184688 Ga0466723_184688_1062_2030 309
94 3300042636 Ga0466703_131678 Ga0466703_131678_50_979 309
95 3300042636 Ga0466703_227232 Ga0466703_227232_473_1402 309
96 3300042656 Ga0466732_000869 Ga0466732_000869_275_1204 309
97 3300042636 Ga0466703_365554 Ga0466703_365554_4279_5211 310
98 3300042648 Ga0466709_034599 Ga0466709_034599_419_1372 310
99 3300042652 Ga0466708_358871 Ga0466708_358871_10555_11487 310
100 3300042601 Ga0466707_090604 Ga0466707_090604_1061_1996 311
101 3300042606 Ga0466719_153948 Ga0466719_153948_5018_5971 312
102 3300042606 Ga0466719_153948 Ga0466719_153948_5018_5971 312
103 3300042612 Ga0466705_228992 Ga0466705_228992_703_1656 312
104 3300010049 Ga0123356_10010959 Ga0123356_100109596 316
105 3300042596 Ga0466696_482387 Ga0466696_482387_2871_3824 317
106 3300042612 Ga0466705_514495 Ga0466705_514495_4423_5376 317
107 3300042612 Ga0466705_514495 Ga0466705_514495_4423_5376 317
108 3300042612 Ga0466705_523129 Ga0466705_523129_15255_16208 317
109 3300042615 Ga0466711_418512 Ga0466711_418512_11358_12311 317
110 3300042618 Ga0466723_021947 Ga0466723_021947_917_1870 317
111 3300042620 Ga0466728_187978 Ga0466728_187978_7950_8903 317
112 3300042620 Ga0466728_196541 Ga0466728_196541_1468_2421 317
113 3300042648 Ga0466709_066047 Ga0466709_066047_2049_3002 317
114 3300042648 Ga0466709_066047 Ga0466709_066047_2049_3002 317
115 3300042648 Ga0466709_258110 Ga0466709_258110_2876_3829 317
116 3300042652 Ga0466708_208103 Ga0466708_208103_358_1311 317
117 3300042652 Ga0466708_360138 Ga0466708_360138_969_1922 317
118 3300042612 Ga0466705_502895 Ga0466705_502895_4750_5706 318
119 3300000089 AustNasuHG_c1033169 AustNasuHG_10331692 321
120 3300005201 Ga0072941_1021556 Ga0072941_10215567 321
121 3300005201 Ga0072941_1021556 Ga0072941_10215567 321
122 3300009784 Ga0123357_10091082 Ga0123357_100910827 321
123 3300042608 Ga0466721_175307 Ga0466721_175307_165_1133 322
124 3300042609 Ga0466722_207323 Ga0466722_207323_1042_2016 324
125 3300038395 Ga0415639_044797 Ga0415639_044797_3088_4065 325

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.8 0.84 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.