Protein Family IF04275
Metagenome
Isolate
128
Members
42
Samples
103
Scaffolds
311.55
Avg Length
Representative Sequence
- ID
- 3300038395|Ga0415639_007622|Ga0415639_007622_27867_28871
- Length
- 334 aa
- Sequence
- MTMAVFYSIMHWAIYIMIPLMVVALGGLFSEKSGVVNIALEGKMILGAFAGTMFMHYMQRVWEVSMPMMLIFVCALVVSTLVGILVSLAHAYAAINLRANQVISGIAINMFAAAFAVFAAHMSIGTQHVHYSRIVTNQSGEVIDSMMITSVPLLGNIPFLGPMLFQNTYFTSLLGIVLLIVASFVLYKTKFGLRLRACGEHPQAADSVGVSVAKMRYAGVILSGALAGMGGIIYIVPVASAFSGSVAGYGFLALAVLIFGAWKPKRIFFAAFFFGLMLSVASQFSGIPFLRDLGIHANFFRMTPYVATLVVLALTSKNTLAPKAVGQPYDKGGR
Sample Types
Isolate
19.5%
Metagenome
80.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
59.5%
Termitidae
31.0%
Kalotermitidae
9.5%
Taxonomy
Archaea
0
Bacteria
120
Eukaryota
0
Viruses
0
Unclassified
8
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820435670 | Unclassified Firmicutes Lab288P3bin217 | Isolate | Unclassified |
| 2 | 2820602899 | Unclassified Firmicutes Emb289P1bin51 | Isolate | Unclassified |
| 3 | 2820698910 | Unclassified Firmicutes Co191P1bin64 | Isolate | Unclassified |
| 4 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 5 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 6 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 7 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 8 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 9 | 2820516196 | Unclassified Firmicutes Lab288P1bin3 | Isolate | Unclassified |
| 10 | 2820518089 | Unclassified Firmicutes Lab288P1bin27 | Isolate | Unclassified |
| 11 | 2820661146 | Unclassified Firmicutes Co191P3bin61 | Isolate | Unclassified |
| 12 | 2820676843 | Unclassified Firmicutes Co191P3bin17 | Isolate | Unclassified |
| 13 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 14 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 15 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 16 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 17 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 18 | 2820587002 | Unclassified Firmicutes Emb289P1bin94 | Isolate | Unclassified |
| 19 | 2820690275 | Unclassified Firmicutes Co191P1bin72 | Isolate | Unclassified |
| 20 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 21 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 22 | 2820442516 | Unclassified Firmicutes Lab288P3bin200 | Isolate | Unclassified |
| 23 | 2820533259 | Unclassified Firmicutes Lab288P1bin140 | Isolate | Unclassified |
| 24 | 2820623020 | Unclassified Firmicutes Emb289P1bin126 | Isolate | Unclassified |
| 25 | 2820696217 | Unclassified Firmicutes Co191P1bin66 | Isolate | Unclassified |
| 26 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 27 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 28 | 2820303403 | Unclassified Firmicutes Th196P1bin2 | Isolate | Unclassified |
| 29 | 2820398208 | Unclassified Firmicutes Nc150P1bin1 | Isolate | Unclassified |
| 30 | 2820522177 | Unclassified Firmicutes Lab288P1bin22 | Isolate | Unclassified |
| 31 | 2820541116 | Unclassified Firmicutes Lab288P1bin109 | Isolate | Unclassified |
| 32 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 33 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 34 | 2820501819 | Unclassified Firmicutes Lab288P1bin51 | Isolate | Unclassified |
| 35 | 2820663833 | Unclassified Firmicutes Co191P3bin41 | Isolate | Unclassified |
| 36 | 2820666966 | Unclassified Firmicutes Co191P3bin39 | Isolate | Unclassified |
| 37 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 38 | 2820329821 | Unclassified Firmicutes Nt197P3bin77 | Isolate | Unclassified |
| 39 | 2820344559 | Unclassified Firmicutes Nt197P3bin63 | Isolate | Unclassified |
| 40 | 2820513949 | Unclassified Firmicutes Lab288P1bin39 | Isolate | Unclassified |
| 41 | 2820627938 | Unclassified Firmicutes Emb289P1bin122 | Isolate | Unclassified |
| 42 | 2820693137 | Unclassified Firmicutes Co191P1bin70 | Isolate | Unclassified |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123355_10038909 | 3300009826 | Bacteria | 7734 |
| 2 | Ga0123353_10004882 | 3300010167 | Bacteria | 17436 |
| 3 | Ga0123353_10589684 | 3300010167 | Unclassified | 1592 |
| 4 | Ga0123353_10706098 | 3300010167 | Bacteria | 1414 |
| 5 | Ga0415639_004341 | 3300038395 | Bacteria | 2356 |
| 6 | Ga0415639_041584 | 3300038395 | Bacteria | 2898 |
| 7 | Ga0466693_019704 | 3300042592 | Bacteria | 1714 |
| 8 | Ga0466725_114229 | 3300042654 | Bacteria | 1631 |
| 9 | Ga0466725_418712 | 3300042654 | Bacteria | 18173 |
| 10 | Ga0123355_10000035 | 3300009826 | Bacteria | 135705 |
| 11 | Ga0123355_10000143 | 3300009826 | Bacteria | 85423 |
| 12 | Ga0123355_10000615 | 3300009826 | Bacteria | 48109 |
| 13 | Ga0123355_10001406 | 3300009826 | Bacteria | 33563 |
| 14 | Ga0123355_10012372 | 3300009826 | Bacteria | 13214 |
| 15 | Ga0123355_10078763 | 3300009826 | Bacteria | 5264 |
| 16 | Ga0123355_10082519 | 3300009826 | Bacteria | 5127 |
| 17 | Ga0123355_10148186 | 3300009826 | Bacteria | 3572 |
| 18 | Ga0123355_10192019 | 3300009826 | Bacteria | 3005 |
| 19 | Ga0123355_10692307 | 3300009826 | Bacteria | 1173 |
| 20 | Ga0123356_10377119 | 3300010049 | Bacteria | 1550 |
| 21 | Ga0123353_10152192 | 3300010167 | Bacteria | 3691 |
| 22 | Ga0466719_286446 | 3300042606 | Bacteria | 42946 |
| 23 | Ga0466719_300822 | 3300042606 | Unclassified | 3897 |
| 24 | Ga0415639_095126 | 3300038395 | Bacteria | 3396 |
| 25 | Ga0466693_103856 | 3300042592 | Bacteria | 6001 |
| 26 | Ga0123355_10000364 | 3300009826 | Bacteria | 58670 |
| 27 | Ga0123355_10031113 | 3300009826 | Bacteria | 8657 |
| 28 | Ga0123355_10071828 | 3300009826 | Bacteria | 5554 |
| 29 | Ga0123355_10094408 | 3300009826 | Bacteria | 4732 |
| 30 | Ga0123355_10255565 | 3300009826 | Bacteria | 2459 |
| 31 | Ga0123355_10500025 | 3300009826 | Bacteria | 1500 |
| 32 | Ga0123353_10000233 | 3300010167 | Bacteria | 70032 |
| 33 | Ga0466714_012950 | 3300042603 | Bacteria | 3440 |
| 34 | JGI24703J35330_11746286 | 3300002501 | Bacteria | 5129 |
| 35 | Ga0123355_10025174 | 3300009826 | Bacteria | 9580 |
| 36 | Ga0123355_10050421 | 3300009826 | Bacteria | 6762 |
| 37 | Ga0123355_10110972 | 3300009826 | Bacteria | 4285 |
| 38 | Ga0123355_10277267 | 3300009826 | Bacteria | 2320 |
| 39 | Ga0123355_10311734 | 3300009826 | Bacteria | 2132 |
| 40 | Ga0123355_10434237 | 3300009826 | Bacteria | 1668 |
| 41 | Ga0123353_10061765 | 3300010167 | Bacteria | 6009 |
| 42 | Ga0466721_097985 | 3300042608 | Bacteria | 27262 |
| 43 | Ga0415639_063026 | 3300038395 | Bacteria | 5491 |
| 44 | JGI24695J34938_10000159 | 3300002450 | Bacteria | 62505 |
| 45 | JGI24695J34938_10019102 | 3300002450 | Bacteria | 3405 |
| 46 | JGI24703J35330_11680350 | 3300002501 | Bacteria | 1804 |
| 47 | Ga0466697_224469 | 3300042611 | Bacteria | 2824 |
| 48 | Ga0466704_045522 | 3300042643 | Bacteria | 8669 |
| 49 | Ga0466725_440614 | 3300042654 | Bacteria | 2927 |
| 50 | Ga0123355_10208161 | 3300009826 | Bacteria | 2841 |
| 51 | Ga0123355_10504141 | 3300009826 | Bacteria | 1491 |
| 52 | Ga0123355_10506833 | 3300009826 | Unclassified | 1485 |
| 53 | Ga0123356_10184139 | 3300010049 | Bacteria | 2113 |
| 54 | Ga0123356_10414999 | 3300010049 | Bacteria | 1487 |
| 55 | Ga0123353_10117758 | 3300010167 | Bacteria | 4272 |
| 56 | Ga0123353_10125188 | 3300010167 | Bacteria | 4130 |
| 57 | Ga0466721_114097 | 3300042608 | Bacteria | 23336 |
| 58 | Ga0466696_200960 | 3300042596 | Bacteria | 1916 |
| 59 | JGI24695J34938_10000005 | 3300002450 | Bacteria | 153903 |
| 60 | Ga0123355_10000578 | 3300009826 | Bacteria | 49407 |
| 61 | Ga0123355_10001011 | 3300009826 | Bacteria | 38991 |
| 62 | Ga0123355_10064105 | 3300009826 | Unclassified | 5924 |
| 63 | Ga0123355_10626965 | 3300009826 | Bacteria | 1265 |
| 64 | Ga0123356_10165868 | 3300010049 | Bacteria | 2213 |
| 65 | Ga0123353_10856900 | 3300010167 | Bacteria | 1244 |
| 66 | Ga0466721_182150 | 3300042608 | Bacteria | 1109 |
| 67 | Ga0466721_192790 | 3300042608 | Bacteria | 3189 |
| 68 | Ga0415639_004764 | 3300038395 | Bacteria | 17886 |
| 69 | Ga0415639_007622 | 3300038395 | Bacteria | 42603 |
| 70 | Ga0415639_017833 | 3300038395 | Bacteria | 8243 |
| 71 | Ga0466725_425575 | 3300042654 | Bacteria | 6511 |
| 72 | Ga0123355_10001365 | 3300009826 | Bacteria | 33977 |
| 73 | Ga0123355_10024294 | 3300009826 | Bacteria | 9741 |
| 74 | Ga0123355_10032779 | 3300009826 | Bacteria | 8433 |
| 75 | Ga0123355_10064975 | 3300009826 | Bacteria | 5877 |
| 76 | Ga0123355_10071579 | 3300009826 | Bacteria | 5565 |
| 77 | Ga0123355_10083244 | 3300009826 | Bacteria | 5100 |
| 78 | Ga0123355_10201743 | 3300009826 | Unclassified | 2903 |
| 79 | Ga0123355_10313801 | 3300009826 | Bacteria | 2121 |
| 80 | Ga0123355_10427644 | 3300009826 | Bacteria | 1687 |
| 81 | Ga0123356_10003366 | 3300010049 | Bacteria | 16796 |
| 82 | Ga0123353_10094611 | 3300010167 | Unclassified | 4814 |
| 83 | Ga0466721_072332 | 3300042608 | Bacteria | 6986 |
| 84 | JGI24703J35330_11722981 | 3300002501 | Bacteria | 2445 |
| 85 | JGI24700J35501_10930542 | 3300002508 | Bacteria | 15354 |
| 86 | Ga0123355_10001226 | 3300009826 | Bacteria | 35782 |
| 87 | Ga0123355_10154473 | 3300009826 | Bacteria | 3476 |
| 88 | Ga0123355_10161365 | 3300009826 | Bacteria | 3376 |
| 89 | Ga0123355_10176708 | 3300009826 | Bacteria | 3178 |
| 90 | Ga0123355_10242925 | 3300009826 | Bacteria | 2548 |
| 91 | Ga0123356_10000225 | 3300010049 | Bacteria | 65755 |
| 92 | Ga0123356_10004395 | 3300010049 | Bacteria | 14569 |
| 93 | Ga0123356_10208793 | 3300010049 | Bacteria | 1999 |
| 94 | Ga0466693_355047 | 3300042592 | Bacteria | 2820 |
| 95 | Ga0466693_380298 | 3300042592 | Bacteria | 2992 |
| 96 | JGI24695J34938_10000340 | 3300002450 | Bacteria | 46153 |
| 97 | JGI24695J34938_10000550 | 3300002450 | Bacteria | 36264 |
| 98 | JGI24695J34938_10032169 | 3300002450 | Unclassified | 2426 |
| 99 | JGI24703J35330_11748754 | 3300002501 | Bacteria | 31354 |
| 100 | Ga0466724_40707 | 3300042649 | Bacteria | 10948 |
| 101 | Ga0466725_247722 | 3300042654 | Bacteria | 2831 |
| 102 | Ga0466725_319543 | 3300042654 | Unclassified | 1084 |
| 103 | Ga0466711_242687 | 3300042615 | Bacteria | 1251 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02653 | BPD_transp_2 | Branched-chain amino acid transport system / permease component | 15 | 288 | 0.89 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.