Protein Family IF04182

Metagenome Isolate
177 Members
47 Samples
161 Scaffolds
258.39 Avg Length

🧬 Representative Sequence

ID
3300024493|Ga0264413_128130|Ga0264413_1281302
Length
258 aa
Sequence
MKYKTKILVERFTEILSAWKGVECITLNEAAEPDPLDPYFALILDVFCNSTIPKAEERCRLYGDDVAAFESAGINEKDRFLIGDIPVRLEFKKTKKIDELIKIACSDHESLWLIKDSGTYGFYRLANCEIVFSRSKWIHDVRKKLGNIKEPFWAEMRNSVQLKMEHFLSDLGAACFQNDKFHYLIASAGFIKNACLTLFCLNKRFEPSHRAYYKQVCELPILPESFSAEFQTFLNDDAADLDSRFYLAKLIAQKIVLL

📊 Sample Types

Isolate 9.0%
Metagenome 91.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 51.1%
Unclassified 35.6%
Kalotermitidae 11.1%
Rhinotermitidae 2.2%

🌳 Taxonomy

Archaea 0
Bacteria 156
Eukaryota 0
Viruses 1
Unclassified 20

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125660 Treponema sp. Emb289P3bin52 Isolate Unclassified
2 2819992462 Unclassified Spirochaetes Nc150P4bin14 Isolate Unclassified
3 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
4 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
5 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
6 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
7 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
8 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
9 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
10 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
11 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
12 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
13 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
14 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
15 2781125643 Treponema sp. Co191P3bin45 Isolate Unclassified
16 2781125664 Treponema sp. Emb289P3bin139 Isolate Unclassified
17 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
18 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
19 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
20 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
21 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
22 2781125636 Treponema sp. Co191P1bin67 Isolate Unclassified
23 2781125662 Treponema sp. Emb289P3bin141 Isolate Unclassified
24 2820020240 Unclassified Spirochaetes Nc150P3bin10 Isolate Unclassified
25 2781125637 Treponema sp. Co191P1bin9 Isolate Unclassified
26 2781125642 Treponema sp. Co191P1bin35 Isolate Unclassified
27 2781125659 Treponema sp. Emb289P3bin114 Isolate Unclassified
28 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
29 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
30 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
31 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
32 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
33 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
34 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
35 2781125638 Treponema sp. Co191P1bin8 Isolate Unclassified
36 2781125649 Treponema sp. Co191P3bin15 Isolate Unclassified
37 2781125661 Treponema sp. Emb289P3bin69 Isolate Unclassified
38 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
39 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
40 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
41 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
42 2781125644 Treponema sp. Co191P3bin12 Isolate Unclassified
43 2781125663 Treponema sp. Emb289P3bin135 Isolate Unclassified
44 2781125665 Treponema sp. Emb289P3bin117 Isolate Unclassified
45 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
46 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
47 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_173818 3300042612 Bacteria 6036
2 Ga0466732_435224 3300042656 Bacteria 23954
3 Ga0466712_234638 3300042614 Bacteria 8887
4 Ga0466712_237794 3300042614 Unclassified 11684
5 JGI24698J34947_10007626 3300002449 Bacteria 5946
6 JGI24698J34947_10033711 3300002449 Bacteria 2684
7 JGI24695J34938_10001419 3300002450 Bacteria 20419
8 JGI24695J34938_10065350 3300002450 Bacteria 1536
9 Ga0072940_1020222 3300005200 Bacteria 18429
10 Ga0072941_1017576 3300005201 Bacteria 11341
11 Ga0072941_1018335 3300005201 Bacteria 20323
12 Ga0072941_1024836 3300005201 Bacteria 6059
13 Ga0072941_1150352 3300005201 Unclassified 1445
14 Ga0123356_10000396 3300010049 Bacteria 49792
15 Ga0123356_10033552 3300010049 Bacteria 4799
16 Ga0415639_077582 3300038395 Bacteria 2232
17 Ga0466694_224505 3300042594 Bacteria 2198
18 Ga0466694_268981 3300042594 Bacteria 11671
19 Ga0466696_052438 3300042596 Bacteria 3758
20 Ga0466717_271862 3300042604 Bacteria 2451
21 Ga0466712_007685 3300042614 Bacteria 25961
22 Ga0466712_030206 3300042614 Unclassified 3677
23 Ga0466712_036358 3300042614 Bacteria 13684
24 Ga0466712_055347 3300042614 Bacteria 5570
25 Ga0466712_319459 3300042614 Bacteria 3112
26 Ga0466718_144473 3300042617 Bacteria 2453
27 AustNasuHG_c1017792 3300000089 Unclassified 2356
28 JGI24698J34947_10032440 3300002449 Bacteria 2743
29 JGI24695J34938_10000849 3300002450 Bacteria 28319
30 JGI24695J34938_10040155 3300002450 Unclassified 2109
31 JGI24695J34938_10108513 3300002450 Bacteria 1132
32 Ga0466702_098944 3300042635 Bacteria 3942
33 Ga0466702_135631 3300042635 Bacteria 1022
34 Ga0123356_10012759 3300010049 Bacteria 8136
35 Ga0123356_10021632 3300010049 Bacteria 6069
36 Ga0123353_10081244 3300010167 Bacteria 5212
37 Ga0264413_106009 3300024493 Bacteria 7347
38 Ga0264413_107400 3300024493 Bacteria 71506
39 Ga0466694_018328 3300042594 Bacteria 67528
40 Ga0466694_046356 3300042594 Bacteria 17602
41 Ga0466694_245729 3300042594 Bacteria 27415
42 Ga0466732_157835 3300042656 Bacteria 7632
43 Ga0466712_049038 3300042614 Bacteria 15357
44 Ga0466718_161024 3300042617 Bacteria 1106
45 AustNasuHG_c1008007 3300000089 Unclassified 3744
46 JGI24698J34947_10060353 3300002449 Bacteria 1871
47 JGI24695J34938_10000289 3300002450 Bacteria 49692
48 JGI24695J34938_10000957 3300002450 Bacteria 26281
49 JGI24695J34938_10001134 3300002450 Bacteria 23869
50 JGI24695J34938_10008613 3300002450 Bacteria 5798
51 Ga0072941_1009325 3300005201 Bacteria 25187
52 Ga0072941_1025544 3300005201 Bacteria 13025
53 Ga0123356_10002045 3300010049 Bacteria 21739
54 Ga0123356_10016354 3300010049 Bacteria 7080
55 Ga0123356_10307550 3300010049 Bacteria 1693
56 Ga0264413_106008 3300024493 Bacteria 3018
57 Ga0264413_127864 3300024493 Unclassified 1528
58 Ga0466694_048227 3300042594 Bacteria 1490
59 Ga0466699_019733 3300042597 Bacteria 43470
60 Ga0466722_132267 3300042609 Bacteria 39034
61 Ga0466712_205507 3300042614 Bacteria 3947
62 Ga0466718_034057 3300042617 Bacteria 5700
63 Ga0466718_089322 3300042617 Bacteria 3672
64 AustNasuHG_c1017030 3300000089 Bacteria 2423
65 JGI24698J34947_10001136 3300002449 Bacteria 13801
66 JGI24698J34947_10004064 3300002449 Bacteria 7949
67 JGI24698J34947_10064548 3300002449 Bacteria 1789
68 JGI24698J34947_10118301 3300002449 Unclassified 1155
69 JGI24695J34938_10000055 3300002450 Bacteria 90507
70 JGI24695J34938_10034100 3300002450 Bacteria 2337
71 Ga0072941_1029401 3300005201 Bacteria 7684
72 Ga0466731_076020 3300042622 Bacteria 1026
73 Ga0466731_193366 3300042622 Bacteria 1131
74 Ga0466702_415748 3300042635 Bacteria 1262
75 Ga0123356_10336374 3300010049 Bacteria 1628
76 Ga0466694_357613 3300042594 Bacteria 3506
77 Ga0466695_290770 3300042595 Bacteria 97007
78 Ga0466719_096197 3300042606 Unclassified 1581
79 Ga0466720_110764 3300042607 Bacteria 6500
80 Ga0466712_004344 3300042614 Unclassified 1136
81 Ga0466712_200953 3300042614 Unclassified 1974
82 Ga0466718_100485 3300042617 Bacteria 8590
83 AustNasuHG_c1011667 3300000089 Bacteria 3043
84 JGI24698J34947_10006602 3300002449 Bacteria 6376
85 JGI24698J34947_10060365 3300002449 Unclassified 1871
86 JGI24695J34938_10000071 3300002450 Bacteria 85834
87 JGI24695J34938_10001207 3300002450 Bacteria 22901
88 JGI24695J34938_10002644 3300002450 Bacteria 13370
89 JGI24695J34938_10052674 3300002450 Bacteria 1774
90 Ga0072941_1001764 3300005201 Bacteria 16180
91 Ga0072941_1005562 3300005201 Bacteria 28183
92 Ga0072941_1010092 3300005201 Bacteria 10814
93 Ga0074263_114896 3300005485 Unclassified 1451
94 Ga0466731_309304 3300042622 Unclassified 3199
95 Ga0123356_10000089 3300010049 Bacteria 95808
96 Ga0123356_10002393 3300010049 Unclassified 20086
97 Ga0466691_021302 3300042593 Bacteria 6351
98 Ga0466694_069476 3300042594 Viruses 1482
99 Ga0466699_235313 3300042597 Bacteria 4199
100 Ga0466700_417854 3300042600 Bacteria 1442
101 Ga0466720_036682 3300042607 Bacteria 2093
102 Ga0466722_229496 3300042609 Bacteria 1454
103 Ga0466698_222145 3300042610 Bacteria 1220
104 Ga0466718_011055 3300042617 Bacteria 2650
105 Ga0466718_013801 3300042617 Bacteria 2237
106 Ga0466718_056723 3300042617 Bacteria 5593
107 Ga0466718_063701 3300042617 Bacteria 10951
108 AustNasuHG_c1001216 3300000089 Bacteria 9275
109 JGI24698J34947_10001397 3300002449 Bacteria 12709
110 JGI24698J34947_10053860 3300002449 Bacteria 2012
111 JGI24698J34947_10054602 3300002449 Bacteria 1994
112 JGI24695J34938_10000164 3300002450 Bacteria 61824
113 JGI24695J34938_10001611 3300002450 Bacteria 18969
114 JGI24695J34938_10004907 3300002450 Bacteria 8559
115 Ga0072940_1000123 3300005200 Bacteria 5101
116 Ga0072941_1017575 3300005201 Bacteria 12242
117 Ga0072941_1055218 3300005201 Bacteria 5372
118 Ga0466702_170379 3300042635 Bacteria 4489
119 Ga0123356_10008083 3300010049 Bacteria 10474
120 Ga0264413_101597 3300024493 Unclassified 6797
121 Ga0264413_101599 3300024493 Bacteria 6656
122 Ga0466694_061359 3300042594 Bacteria 15297
123 Ga0466694_085597 3300042594 Bacteria 22151
124 Ga0466700_206405 3300042600 Bacteria 1159
125 Ga0466720_016274 3300042607 Bacteria 8133
126 Ga0466721_226714 3300042608 Bacteria 3734
127 Ga0466698_205534 3300042610 Bacteria 27202
128 Ga0466712_275821 3300042614 Bacteria 6830
129 Ga0466718_028202 3300042617 Bacteria 3892
130 Ga0466723_239728 3300042618 Bacteria 39695
131 AustNasuHG_c1004006 3300000089 Unclassified 5300
132 JGI24698J34947_10013310 3300002449 Bacteria 4494
133 JGI24698J34947_10103721 3300002449 Bacteria 1271
134 JGI24695J34938_10000222 3300002450 Bacteria 54147
135 JGI24699J35502_11130525 3300002509 Unclassified 5157
136 Ga0072940_1049437 3300005200 Bacteria 5457
137 Ga0072941_1004218 3300005201 Bacteria 9368
138 Ga0072941_1025542 3300005201 Bacteria 2325
139 Ga0123356_10000116 3300010049 Bacteria 86622
140 Ga0123356_10004873 3300010049 Bacteria 13790
141 Ga0123356_10103256 3300010049 Unclassified 2738
142 Ga0123356_10120110 3300010049 Bacteria 2554
143 Ga0466699_127018 3300042597 Bacteria 3359
144 Ga0466720_203082 3300042607 Bacteria 8666
145 Ga0466712_009252 3300042614 Bacteria 23602
146 Ga0466712_088685 3300042614 Bacteria 8879
147 Ga0466712_261145 3300042614 Bacteria 13881
148 Ga0466712_269548 3300042614 Bacteria 6725
149 AustNasuHG_c1034750 3300000089 Bacteria 1342
150 JGI24698J34947_10000008 3300002449 Bacteria 53028
151 JGI24698J34947_10058625 3300002449 Bacteria 1906
152 JGI24695J34938_10000582 3300002450 Bacteria 35275
153 JGI24695J34938_10001125 3300002450 Bacteria 24008
154 Ga0123356_10003304 3300010049 Bacteria 16938
155 Ga0123354_10260177 3300010882 Bacteria 1735
156 Ga0264413_101598 3300024493 Bacteria 2385
157 Ga0264413_128130 3300024493 Unclassified 3000
158 Ga0415639_002261 3300038395 Bacteria 19354
159 Ga0466700_030989 3300042600 Bacteria 7971
160 Ga0466720_225298 3300042607 Bacteria 3089
161 Ga0466698_451589 3300042610 Bacteria 1724

🧩 MSA Aligner

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.