Protein Family IF04169

Metagenome Isolate
149 Members
37 Samples
140 Scaffolds
107.28 Avg Length

🧬 Representative Sequence

ID
3300024493|Ga0264413_111305|Ga0264413_1113057
Length
125 aa
Sequence
MISGIKKPFIYNFIEKYMTAKKYTKADIIDALYEKTGMSRTEIRGAIDHLIDEMREALMRRQIIELRGLGTFEVKVRKARPRARNPRTGETITIRSHGAVTFRSGRDLKQAVWNITDDDKPAKKR

📊 Sample Types

Isolate 6.0%
Metagenome 94.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 64.7%
Unclassified 26.5%
Rhinotermitidae 8.8%

🌳 Taxonomy

Archaea 0
Bacteria 139
Eukaryota 0
Viruses 1
Unclassified 9

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2819992462 Unclassified Spirochaetes Nc150P4bin14 Isolate Unclassified
2 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
3 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
4 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
5 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
6 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
7 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
8 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
9 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
10 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
11 2781125663 Treponema sp. Emb289P3bin135 Isolate Unclassified
12 2781125665 Treponema sp. Emb289P3bin117 Isolate Unclassified
13 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
14 2781125642 Treponema sp. Co191P1bin35 Isolate Unclassified
15 2781125646 Treponema sp. Co191P3bin59 Isolate Unclassified
16 2781125692 Treponema sp. Th196P3bin31 Isolate Unclassified
17 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
18 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
19 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
20 2781125636 Treponema sp. Co191P1bin67 Isolate Unclassified
21 2820020240 Unclassified Spirochaetes Nc150P3bin10 Isolate Unclassified
22 3300001880 Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome Metagenome
23 2228664004 P3 Gut Segment Termite Single Cell Genome_Treponema sp. T3b, from Florida USA Metagenome Termitidae
24 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
25 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
26 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
27 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
28 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
29 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
30 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
31 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
32 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
33 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
34 2781125657 Treponema sp. Emb289P3bin15 Isolate Unclassified
35 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
36 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
37 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123353_10130242 3300010167 Bacteria 4038
2 Ga0123353_10684888 3300010167 Bacteria 1443
3 Ga0466712_175957 3300042614 Bacteria 10105
4 Ga0466718_031808 3300042617 Bacteria 11464
5 Ga0466718_053207 3300042617 Bacteria 3487
6 Ga0466718_165921 3300042617 Bacteria 3153
7 Ga0466702_061015 3300042635 Bacteria 11994
8 AustNasuHG_c1000139 3300000089 Bacteria 22520
9 AustNasuHG_c1004102 3300000089 Bacteria 5234
10 AustNasuHG_c1018721 3300000089 Bacteria 2280
11 FAAS_10468750 3300001880 Bacteria 570
12 JGI24695J34938_10000947 3300002450 Bacteria 26470
13 JGI24695J34938_10049727 3300002450 Unclassified 1842
14 JGI24695J34938_10058596 3300002450 Unclassified 1651
15 Ga0466692_081109 3300042591 Bacteria 10324
16 Ga0466692_110321 3300042591 Bacteria 1347
17 Ga0466693_253926 3300042592 Bacteria 16135
18 Ga0466694_020203 3300042594 Bacteria 8825
19 Ga0466699_335402 3300042597 Bacteria 1091
20 Ga0466732_008846 3300042656 Bacteria 18049
21 Ga0466720_090063 3300042607 Bacteria 5155
22 Ga0466722_091193 3300042609 Bacteria 1135
23 Ga0466718_013194 3300042617 Bacteria 1472
24 Ga0466718_040204 3300042617 Bacteria 13075
25 Ga0466702_281606 3300042635 Bacteria 1375
26 Ga0466702_466217 3300042635 Bacteria 13914
27 AustNasuHG_c1000705 3300000089 Bacteria 11869
28 JGI24698J34947_10000003 3300002449 Bacteria 62691
29 JGI24698J34947_10000241 3300002449 Bacteria 22787
30 JGI24695J34938_10001512 3300002450 Bacteria 19609
31 Ga0072941_1036612 3300005201 Bacteria 2152
32 Ga0264413_105646 3300024493 Bacteria 11070
33 Ga0466694_044360 3300042594 Bacteria 13614
34 Ga0466694_050416 3300042594 Bacteria 11268
35 Ga0466694_363261 3300042594 Bacteria 2213
36 Ga0123356_10011644 3300010049 Bacteria 8566
37 Ga0123356_10020998 3300010049 Bacteria 6176
38 Ga0123356_11429822 3300010049 Bacteria 851
39 Ga0123356_11804093 3300010049 Bacteria 760
40 Ga0466720_008542 3300042607 Bacteria 40016
41 Ga0466722_148307 3300042609 Bacteria 14415
42 Ga0466698_193877 3300042610 Bacteria 6301
43 Ga0466718_027524 3300042617 Bacteria 6931
44 Ga0466718_091341 3300042617 Bacteria 6874
45 Ga0466718_107693 3300042617 Bacteria 1771
46 Ga0466702_131781 3300042635 Unclassified 1326
47 JGI24698J34947_10029557 3300002449 Bacteria 2894
48 JGI24698J34947_10063453 3300002449 Bacteria 1810
49 JGI24695J34938_10003575 3300002450 Bacteria 10710
50 JGI24695J34938_10032174 3300002450 Bacteria 2426
51 Ga0072940_1159178 3300005200 Bacteria 1352
52 Ga0466699_337164 3300042597 Bacteria 4272
53 Ga0466722_262071 3300042609 Bacteria 23442
54 Ga0466712_050950 3300042614 Bacteria 10029
55 Ga0466712_112470 3300042614 Bacteria 9678
56 Ga0466718_025713 3300042617 Bacteria 9249
57 Ga0466718_032195 3300042617 Bacteria 6361
58 Ga0466718_078022 3300042617 Bacteria 5978
59 Ga0466718_143385 3300042617 Bacteria 10840
60 Ga0466730_017903 3300042625 Bacteria 2424
61 FAAS_10001006 3300001880 Bacteria 2683
62 JGI24698J34947_10006121 3300002449 Bacteria 6604
63 JGI24695J34938_10003321 3300002450 Bacteria 11335
64 Ga0072941_1032758 3300005201 Bacteria 9046
65 Ga0264413_105394 3300024493 Bacteria 9961
66 Ga0264413_114977 3300024493 Bacteria 37616
67 Ga0415639_067896 3300038395 Bacteria 4435
68 Ga0466695_357140 3300042595 Bacteria 35004
69 Ga0466699_159306 3300042597 Bacteria 2000
70 Ga0123356_10000453 3300010049 Bacteria 46109
71 Ga0123356_10020064 3300010049 Bacteria 6330
72 Ga0466712_056613 3300042614 Bacteria 12902
73 Ga0466718_149328 3300042617 Bacteria 9484
74 JGI24698J34947_10066562 3300002449 Bacteria 1752
75 JGI24695J34938_10000112 3300002450 Bacteria 72784
76 JGI24695J34938_10000553 3300002450 Bacteria 36121
77 JGI24695J34938_10001156 3300002450 Bacteria 23495
78 JGI24695J34938_10002792 3300002450 Bacteria 12795
79 JGI24695J34938_10003362 3300002450 Bacteria 11246
80 Ga0072941_1045063 3300005201 Bacteria 3140
81 Ga0466692_082614 3300042591 Bacteria 2744
82 Ga0466692_087331 3300042591 Bacteria 1790
83 Ga0466694_081947 3300042594 Bacteria 6292
84 Ga0466732_429868 3300042656 Unclassified 4917
85 Ga0123356_10107073 3300010049 Bacteria 2693
86 Ga0466722_129704 3300042609 Bacteria 1187
87 Ga0466712_314821 3300042614 Bacteria 22070
88 Ga0466731_140819 3300042622 Bacteria 1521
89 Ga0466731_146462 3300042622 Bacteria 2825
90 Ga0466702_004209 3300042635 Bacteria 8955
91 AustNasuHG_c1025276 3300000089 Bacteria 1867
92 AustNasuHG_c1062326 3300000089 Bacteria 715
93 JGI24695J34938_10000139 3300002450 Bacteria 65941
94 JGI24695J34938_10300532 3300002450 Bacteria 693
95 Ga0264413_111305 3300024493 Bacteria 10078
96 Ga0415639_166680 3300038395 Bacteria 1686
97 Ga0466732_008974 3300042656 Bacteria 2226
98 Ga0123356_10001386 3300010049 Bacteria 26875
99 Ga0123356_10156528 3300010049 Bacteria 2270
100 Ga0466720_014621 3300042607 Bacteria 102324
101 Ga0466721_256306 3300042608 Bacteria 1308
102 Ga0466712_317612 3300042614 Bacteria 15050
103 Ga0466718_078886 3300042617 Bacteria 4971
104 Ga0466731_105684 3300042622 Bacteria 9404
105 Ga0466702_040302 3300042635 Unclassified 2177
106 Ga0466702_070573 3300042635 Bacteria 1624
107 AustNasuHG_c1006015 3300000089 Bacteria 4336
108 JGI24698J34947_10021443 3300002449 Bacteria 3474
109 JGI24695J34938_10030990 3300002450 Bacteria 2486
110 Ga0072940_1023360 3300005200 Bacteria 34349
111 Ga0072941_1198974 3300005201 Bacteria 1416
112 Ga0264413_112885 3300024493 Bacteria 1586
113 Ga0264413_135444 3300024493 Bacteria 8551
114 Ga0415639_060857 3300038395 Bacteria 6958
115 Ga0456237_0000739 3300041968 Bacteria 5043
116 Ga0466692_178154 3300042591 Bacteria 3203
117 Ga0466699_063466 3300042597 Unclassified 2061
118 Ga0123356_10017470 3300010049 Bacteria 6824
119 Ga0123353_10138372 3300010167 Bacteria 3903
120 Ga0466700_157299 3300042600 Bacteria 11405
121 Ga0466720_048686 3300042607 Bacteria 8213
122 Ga0466720_226106 3300042607 Bacteria 4541
123 Ga0466722_032167 3300042609 Bacteria 1566
124 Ga0466722_246826 3300042609 Bacteria 2223
125 Ga0466698_398352 3300042610 Bacteria 4197
126 Ga0466712_064105 3300042614 Bacteria 16193
127 Ga0466712_149807 3300042614 Bacteria 5337
128 Ga0466718_006444 3300042617 Bacteria 75149
129 Ga0466718_047268 3300042617 Bacteria 7832
130 Ga0466731_186790 3300042622 Bacteria 8951
131 Ga0466731_334782 3300042622 Viruses 8237
132 2230969608 2228664004 Bacteria 12014
133 AustNasuHG_c1082925 3300000089 Bacteria 536
134 JGI24695J34938_10031881 3300002450 Unclassified 2441
135 JGI24695J34938_10077805 3300002450 Unclassified 1375
136 Ga0264413_112886 3300024493 Unclassified 1780
137 Ga0466693_316245 3300042592 Bacteria 9075
138 Ga0466699_186379 3300042597 Bacteria 1886
139 Ga0466699_386670 3300042597 Bacteria 1404
140 Ga0466699_425188 3300042597 Bacteria 97421

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00216 Bac_DNA_binding Bacterial DNA-binding protein 24 112 0.99
PF18291 HU-HIG HU domain fused to wHTH, Ig, or Glycine-rich motif 18 112 0.83

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.