Protein Family IF04152
Metagenome
Isolate
131
Members
39
Samples
127
Scaffolds
217.89
Avg Length
Representative Sequence
- ID
- 3300024493|Ga0264413_101326|Ga0264413_1013264
- Length
- 254 aa
- Sequence
- MVLFFRRSLDYAEKHFEYTVITMLHLVVFLGNPGEKYQHNRHNAGWILAEALPFFPILDWQKKFKALYANVDSARIAPPDDPSTGVPQAALPETRPEKLHFIKPQTYMNHSGEAVLAAAMFYKVKLNEIVVVHDEIELPFGTLSLKFSGGLGGHNGLRSMKSCFGSADFWRLRIGIGRPDDRIPGKGGNIESSRDAGIADWVLSDFTPAEAEALVPVYNAGAGLLLQALAAEPEQLMSQWVKKDCLAITPETVI
Sample Types
Isolate
3.0%
Metagenome
97.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
54.1%
Kalotermitidae
18.9%
Unclassified
13.5%
Rhinotermitidae
8.1%
Termopsidae
5.4%
Taxonomy
Archaea
0
Bacteria
127
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125633 | Treponema sp. Co191P1bin38 | Isolate | Unclassified |
| 2 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 3 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 4 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 5 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 6 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 7 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 8 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 9 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 10 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 11 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 12 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 13 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 14 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 15 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 16 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 17 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 18 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 19 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 20 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 21 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 22 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 23 | 2781125658 | Treponema sp. Emb289P3bin37 | Isolate | Unclassified |
| 24 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 25 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 26 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 27 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 28 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 29 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 30 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 31 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 32 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 33 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 34 | 2781125640 | Treponema sp. Co191P1bin37 | Isolate | Unclassified |
| 35 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 36 | 2781125693 | Treponema sp. Th196P3bin148 | Isolate | Unclassified |
| 37 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 38 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 39 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_149293 | 3300042659 | Bacteria | 2596 |
| 2 | Ga0466720_195092 | 3300042607 | Bacteria | 3704 |
| 3 | Ga0466720_219584 | 3300042607 | Bacteria | 92443 |
| 4 | Ga0264413_129930 | 3300024493 | Bacteria | 1466 |
| 5 | Ga0415639_172808 | 3300038395 | Bacteria | 1029 |
| 6 | Ga0466694_308365 | 3300042594 | Bacteria | 3242 |
| 7 | Ga0466699_005247 | 3300042597 | Bacteria | 1372 |
| 8 | Ga0466699_022690 | 3300042597 | Bacteria | 8057 |
| 9 | Ga0466731_206150 | 3300042622 | Bacteria | 2053 |
| 10 | Ga0466704_032310 | 3300042643 | Bacteria | 4873 |
| 11 | Ga0466712_003411 | 3300042614 | Bacteria | 2061 |
| 12 | Ga0466718_047660 | 3300042617 | Bacteria | 22268 |
| 13 | Ga0466726_260815 | 3300042619 | Bacteria | 9050 |
| 14 | JGI24698J34947_10031143 | 3300002449 | Bacteria | 2810 |
| 15 | Ga0466705_053880 | 3300042612 | Bacteria | 18203 |
| 16 | Ga0466732_141977 | 3300042656 | Bacteria | 3478 |
| 17 | Ga0466733_159933 | 3300042659 | Bacteria | 2175 |
| 18 | Ga0466719_029144 | 3300042606 | Bacteria | 5689 |
| 19 | Ga0466720_016246 | 3300042607 | Bacteria | 14230 |
| 20 | Ga0466720_061489 | 3300042607 | Bacteria | 28276 |
| 21 | Ga0466720_220587 | 3300042607 | Bacteria | 15256 |
| 22 | Ga0264413_101326 | 3300024493 | Bacteria | 14997 |
| 23 | Ga0466693_167551 | 3300042592 | Bacteria | 2521 |
| 24 | Ga0466699_044086 | 3300042597 | Bacteria | 9553 |
| 25 | Ga0466699_128347 | 3300042597 | Bacteria | 4542 |
| 26 | Ga0466699_263868 | 3300042597 | Bacteria | 7033 |
| 27 | Ga0466727_088450 | 3300042655 | Bacteria | 11470 |
| 28 | Ga0466715_510237 | 3300042616 | Bacteria | 5388 |
| 29 | Ga0123353_10437305 | 3300010167 | Bacteria | 1931 |
| 30 | AustNasuHG_c1003178 | 3300000089 | Bacteria | 5927 |
| 31 | JGI24695J34938_10002069 | 3300002450 | Bacteria | 15755 |
| 32 | Ga0072941_1011778 | 3300005201 | Bacteria | 17019 |
| 33 | Ga0466705_121698 | 3300042612 | Unclassified | 4005 |
| 34 | Ga0466733_064101 | 3300042659 | Bacteria | 2706 |
| 35 | Ga0466733_194615 | 3300042659 | Bacteria | 2752 |
| 36 | Ga0466722_202438 | 3300042609 | Bacteria | 1404 |
| 37 | Ga0466698_140163 | 3300042610 | Bacteria | 4337 |
| 38 | Ga0264413_101328 | 3300024493 | Bacteria | 17843 |
| 39 | Ga0466692_017665 | 3300042591 | Bacteria | 1561 |
| 40 | Ga0466699_153242 | 3300042597 | Bacteria | 1979 |
| 41 | Ga0466704_334572 | 3300042643 | Bacteria | 24393 |
| 42 | Ga0466704_477219 | 3300042643 | Bacteria | 9167 |
| 43 | Ga0466712_116744 | 3300042614 | Bacteria | 3054 |
| 44 | Ga0466718_060705 | 3300042617 | Bacteria | 1895 |
| 45 | Ga0123356_10690932 | 3300010049 | Bacteria | 1189 |
| 46 | JGI24698J34947_10039152 | 3300002449 | Bacteria | 2455 |
| 47 | Ga0466705_061844 | 3300042612 | Bacteria | 19818 |
| 48 | Ga0466732_179513 | 3300042656 | Bacteria | 6128 |
| 49 | Ga0466733_064564 | 3300042659 | Bacteria | 1563 |
| 50 | Ga0466733_174620 | 3300042659 | Bacteria | 37650 |
| 51 | Ga0466700_397730 | 3300042600 | Bacteria | 4242 |
| 52 | Ga0466720_006297 | 3300042607 | Bacteria | 9258 |
| 53 | Ga0466720_053195 | 3300042607 | Bacteria | 3755 |
| 54 | Ga0264413_110117 | 3300024493 | Bacteria | 4435 |
| 55 | Ga0415639_006299 | 3300038395 | Bacteria | 3635 |
| 56 | Ga0466699_105720 | 3300042597 | Bacteria | 1921 |
| 57 | Ga0466727_266838 | 3300042655 | Bacteria | 7593 |
| 58 | JGI24698J34947_10017071 | 3300002449 | Bacteria | 3937 |
| 59 | JGI24698J34947_10032676 | 3300002449 | Bacteria | 2731 |
| 60 | JGI24698J34947_10068190 | 3300002449 | Bacteria | 1722 |
| 61 | JGI24698J34947_10170625 | 3300002449 | Bacteria | 881 |
| 62 | JGI24695J34938_10006466 | 3300002450 | Bacteria | 7028 |
| 63 | Ga0466733_204252 | 3300042659 | Bacteria | 6772 |
| 64 | Ga0466714_137589 | 3300042603 | Bacteria | 1374 |
| 65 | Ga0466720_075512 | 3300042607 | Bacteria | 1990 |
| 66 | Ga0466722_014968 | 3300042609 | Bacteria | 4660 |
| 67 | Ga0466722_125237 | 3300042609 | Bacteria | 8258 |
| 68 | Ga0466722_263862 | 3300042609 | Bacteria | 1618 |
| 69 | Ga0466699_147926 | 3300042597 | Bacteria | 10380 |
| 70 | Ga0466729_282570 | 3300042621 | Bacteria | 1526 |
| 71 | Ga0466703_234809 | 3300042636 | Bacteria | 5385 |
| 72 | Ga0466703_346631 | 3300042636 | Bacteria | 13677 |
| 73 | Ga0466704_369287 | 3300042643 | Bacteria | 41126 |
| 74 | Ga0466708_009081 | 3300042652 | Bacteria | 16963 |
| 75 | Ga0466712_083358 | 3300042614 | Unclassified | 1857 |
| 76 | JGI24698J34947_10038298 | 3300002449 | Unclassified | 2487 |
| 77 | JGI24698J34947_10041805 | 3300002449 | Bacteria | 2359 |
| 78 | JGI24698J34947_10043533 | 3300002449 | Bacteria | 2301 |
| 79 | JGI24695J34938_10016191 | 3300002450 | Bacteria | 3802 |
| 80 | JGI24695J34938_10082856 | 3300002450 | Bacteria | 1323 |
| 81 | Ga0466713_043248 | 3300042602 | Bacteria | 1429 |
| 82 | Ga0466719_033349 | 3300042606 | Bacteria | 8038 |
| 83 | Ga0466720_024744 | 3300042607 | Bacteria | 3782 |
| 84 | Ga0466720_105589 | 3300042607 | Bacteria | 21921 |
| 85 | Ga0466720_111582 | 3300042607 | Bacteria | 4476 |
| 86 | Ga0466722_060339 | 3300042609 | Bacteria | 2187 |
| 87 | Ga0466722_073016 | 3300042609 | Bacteria | 3540 |
| 88 | Ga0466699_249129 | 3300042597 | Bacteria | 3768 |
| 89 | Ga0466718_003631 | 3300042617 | Bacteria | 1998 |
| 90 | Ga0466729_051181 | 3300042621 | Bacteria | 2110 |
| 91 | JGI24698J34947_10025679 | 3300002449 | Bacteria | 3133 |
| 92 | JGI24695J34938_10019717 | 3300002450 | Bacteria | 3333 |
| 93 | JGI24695J34938_10038266 | 3300002450 | Bacteria | 2174 |
| 94 | Ga0466720_179524 | 3300042607 | Bacteria | 3795 |
| 95 | Ga0466722_021681 | 3300042609 | Bacteria | 5072 |
| 96 | Ga0466722_023137 | 3300042609 | Bacteria | 6046 |
| 97 | Ga0466722_081919 | 3300042609 | Bacteria | 3326 |
| 98 | Ga0466698_504507 | 3300042610 | Bacteria | 1759 |
| 99 | Ga0466699_186074 | 3300042597 | Unclassified | 3776 |
| 100 | Ga0466699_333667 | 3300042597 | Bacteria | 2098 |
| 101 | Ga0466699_384820 | 3300042597 | Bacteria | 1438 |
| 102 | Ga0466718_121705 | 3300042617 | Bacteria | 1208 |
| 103 | JGI24698J34947_10004296 | 3300002449 | Bacteria | 7755 |
| 104 | JGI24698J34947_10027365 | 3300002449 | Bacteria | 3026 |
| 105 | JGI24698J34947_10042279 | 3300002449 | Bacteria | 2343 |
| 106 | JGI24698J34947_10176542 | 3300002449 | Bacteria | 858 |
| 107 | JGI24695J34938_10017778 | 3300002450 | Bacteria | 3572 |
| 108 | JGI24695J34938_10112054 | 3300002450 | Bacteria | 1111 |
| 109 | Ga0466698_079903 | 3300042610 | Bacteria | 3807 |
| 110 | Ga0466692_107453 | 3300042591 | Bacteria | 4642 |
| 111 | Ga0466699_082919 | 3300042597 | Bacteria | 2372 |
| 112 | Ga0466699_085893 | 3300042597 | Bacteria | 1067 |
| 113 | Ga0466699_175597 | 3300042597 | Bacteria | 3290 |
| 114 | Ga0466699_295040 | 3300042597 | Bacteria | 23711 |
| 115 | Ga0466699_415714 | 3300042597 | Bacteria | 1165 |
| 116 | Ga0466703_423653 | 3300042636 | Bacteria | 3560 |
| 117 | Ga0466712_106237 | 3300042614 | Bacteria | 6711 |
| 118 | Ga0466726_095226 | 3300042619 | Bacteria | 1074 |
| 119 | Ga0466728_431233 | 3300042620 | Bacteria | 6305 |
| 120 | Ga0123355_10038761 | 3300009826 | Bacteria | 7749 |
| 121 | Ga0123355_10175089 | 3300009826 | Bacteria | 3197 |
| 122 | Ga0123356_10002291 | 3300010049 | Bacteria | 20601 |
| 123 | JGI24698J34947_10005025 | 3300002449 | Bacteria | 7246 |
| 124 | JGI24698J34947_10014463 | 3300002449 | Bacteria | 4298 |
| 125 | JGI24698J34947_10051813 | 3300002449 | Bacteria | 2062 |
| 126 | JGI24695J34938_10024873 | 3300002450 | Bacteria | 2871 |
| 127 | Ga0123357_10001297 | 3300009784 | Bacteria | 26360 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01195 | Pept_tRNA_hydro | Peptidyl-tRNA hydrolase | 26 | 239 | 0.93 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01195 | GO:0004045 | aminoacyl-tRNA hydrolase activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.