Protein Family IF03880
Metagenome
Isolate
129
Members
37
Samples
125
Scaffolds
474.67
Avg Length
Representative Sequence
- ID
- 3300012845|Ga0160460_100029|Ga0160460_10002965
- Length
- 474 aa
- Sequence
- MTKHNFKIGLFGIGLDTYWPQFKGLEQRLIGYLAQVETKISAYGAEVLNLGLIDNADKAFTAGHDFKKGDVDVIFLYVTTYALSSTVLPVVRRAKVPVIILNLVPEKAIDYKNFNQLKDRTKMTGDWLAFCSACPVPEIANVFKRSGIQFHQVTGVLNDEETWEEIGDWVEVAKVVHTMSHNTLGLMGNYYSGMLDIYSDLTLQCAVFGNHIEIIEPDELTALRDDATESEVKAKTEEFKKLFEIDSSCEEVELDKAAKTAVALDKLVNQYDLGSMAYYHNGTGNANADTMSSIILGNSILTAKGIPVAGEYEVKNAQAMKIMDSFGVGGSFTEYYAMDFEDDVVLMGHDGPGHLAIAEGKIKVKPLQVYHGKVGSGLSVEMSVKHGPVTLLSVVESNCKIFLLIAEGESVAGPILEIGNTNSRYCFPIGAKKFTENWNNNGPAHHCAVGIGHIGNKLIKLAGLLNIEVIKIC*
Sample Types
Isolate
3.1%
Metagenome
96.9%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
37.8%
Termitidae
21.6%
Unclassified
16.2%
Termopsidae
10.8%
Rhinotermitidae
8.1%
Passalidae
2.7%
Culicidae
2.7%
Taxonomy
Archaea
0
Bacteria
128
Eukaryota
0
Viruses
0
Unclassified
1
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125629 | Treponema sp. Nt197P3bin20 | Isolate | Unclassified |
| 2 | 2820750388 | Unclassified Bacteroidetes Nt197P3bin50 | Isolate | Unclassified |
| 3 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 4 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 5 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 6 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 7 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 8 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 9 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 10 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 11 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 12 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 13 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 14 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 15 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 16 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 17 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 18 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 19 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 20 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 21 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 22 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 23 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 24 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 25 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 26 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 27 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 28 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 29 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 30 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 31 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 32 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 33 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 34 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 35 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 36 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 37 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123353_10004495 | 3300010167 | Bacteria | 17967 |
| 2 | Ga0123353_10098710 | 3300010167 | Bacteria | 4706 |
| 3 | Ga0123353_10131298 | 3300010167 | Bacteria | 4019 |
| 4 | Ga0466707_261484 | 3300042601 | Bacteria | 6462 |
| 5 | Ga0466713_010490 | 3300042602 | Bacteria | 17574 |
| 6 | Ga0466713_123635 | 3300042602 | Bacteria | 23342 |
| 7 | Ga0466714_028618 | 3300042603 | Bacteria | 1845 |
| 8 | Ga0466691_097197 | 3300042593 | Bacteria | 15697 |
| 9 | Ga0466696_396070 | 3300042596 | Bacteria | 2802 |
| 10 | JGI24702J35022_10017051 | 3300002462 | Bacteria | 3975 |
| 11 | Ga0466735_195684 | 3300042624 | Bacteria | 2717 |
| 12 | Ga0466703_062086 | 3300042636 | Bacteria | 35310 |
| 13 | Ga0466703_421040 | 3300042636 | Bacteria | 5537 |
| 14 | Ga0466704_034204 | 3300042643 | Bacteria | 4192 |
| 15 | Ga0466704_076070 | 3300042643 | Bacteria | 1862 |
| 16 | Ga0466709_088187 | 3300042648 | Bacteria | 9559 |
| 17 | Ga0466709_199923 | 3300042648 | Bacteria | 96862 |
| 18 | Ga0466733_179449 | 3300042659 | Bacteria | 3251 |
| 19 | Ga0123353_10490906 | 3300010167 | Bacteria | 1793 |
| 20 | Ga0466716_333668 | 3300042605 | Bacteria | 12616 |
| 21 | Ga0466719_553372 | 3300042606 | Bacteria | 3338 |
| 22 | Ga0160460_100029 | 3300012845 | Bacteria | 324685 |
| 23 | Ga0466690_074668 | 3300042590 | Bacteria | 8168 |
| 24 | Ga0466696_127513 | 3300042596 | Unclassified | 2304 |
| 25 | JGI24705J35276_12233570 | 3300002504 | Bacteria | 4919 |
| 26 | Ga0466704_213973 | 3300042643 | Bacteria | 2162 |
| 27 | Ga0466708_296578 | 3300042652 | Bacteria | 35153 |
| 28 | Ga0466727_077675 | 3300042655 | Bacteria | 3279 |
| 29 | Ga0466727_221814 | 3300042655 | Bacteria | 2386 |
| 30 | Ga0466715_052253 | 3300042616 | Bacteria | 13554 |
| 31 | Ga0466723_243642 | 3300042618 | Bacteria | 11920 |
| 32 | Ga0466726_124996 | 3300042619 | Bacteria | 1737 |
| 33 | Ga0466726_409601 | 3300042619 | Bacteria | 2537 |
| 34 | Ga0466707_059515 | 3300042601 | Bacteria | 7530 |
| 35 | Ga0466707_385406 | 3300042601 | Bacteria | 3232 |
| 36 | Ga0466722_111299 | 3300042609 | Bacteria | 5447 |
| 37 | AustNasuHG_c1001812 | 3300000089 | Bacteria | 7726 |
| 38 | Ga0466703_039954 | 3300042636 | Bacteria | 32713 |
| 39 | Ga0466703_313520 | 3300042636 | Bacteria | 4911 |
| 40 | Ga0466709_086644 | 3300042648 | Bacteria | 14610 |
| 41 | Ga0466705_478499 | 3300042612 | Bacteria | 12196 |
| 42 | Ga0466715_643669 | 3300042616 | Bacteria | 9131 |
| 43 | Ga0466723_050067 | 3300042618 | Bacteria | 11000 |
| 44 | Ga0466707_022609 | 3300042601 | Bacteria | 2607 |
| 45 | Ga0466707_382905 | 3300042601 | Bacteria | 3267 |
| 46 | Ga0466713_047571 | 3300042602 | Bacteria | 55256 |
| 47 | Ga0466713_144658 | 3300042602 | Bacteria | 46382 |
| 48 | Ga0466690_093332 | 3300042590 | Bacteria | 19968 |
| 49 | Ga0466692_107738 | 3300042591 | Bacteria | 10153 |
| 50 | Ga0466691_079817 | 3300042593 | Bacteria | 16366 |
| 51 | Ga0466694_206587 | 3300042594 | Bacteria | 6907 |
| 52 | Ga0466696_066748 | 3300042596 | Bacteria | 4348 |
| 53 | AustNasuHG_c1002678 | 3300000089 | Bacteria | 6431 |
| 54 | JGI24698J34947_10009301 | 3300002449 | Bacteria | 5394 |
| 55 | Ga0466705_105915 | 3300042612 | Bacteria | 14879 |
| 56 | Ga0466704_390074 | 3300042643 | Bacteria | 4409 |
| 57 | Ga0466708_367106 | 3300042652 | Bacteria | 72455 |
| 58 | Ga0466727_110796 | 3300042655 | Bacteria | 2691 |
| 59 | Ga0466711_224242 | 3300042615 | Bacteria | 29340 |
| 60 | Ga0466711_233811 | 3300042615 | Bacteria | 27406 |
| 61 | Ga0466723_151775 | 3300042618 | Bacteria | 1930 |
| 62 | Ga0466707_407335 | 3300042601 | Bacteria | 27153 |
| 63 | Ga0466713_022472 | 3300042602 | Bacteria | 48965 |
| 64 | Ga0466713_134683 | 3300042602 | Bacteria | 1778 |
| 65 | Ga0466719_397574 | 3300042606 | Bacteria | 3624 |
| 66 | Ga0466696_015634 | 3300042596 | Bacteria | 13458 |
| 67 | Ga0466696_133294 | 3300042596 | Bacteria | 14875 |
| 68 | Ga0068302_10106391 | 3300005071 | Bacteria | 1737 |
| 69 | Ga0466705_064830 | 3300042612 | Bacteria | 19081 |
| 70 | Ga0466705_069841 | 3300042612 | Bacteria | 12967 |
| 71 | Ga0466727_013197 | 3300042655 | Bacteria | 14073 |
| 72 | Ga0466727_294687 | 3300042655 | Bacteria | 4191 |
| 73 | Ga0466711_445925 | 3300042615 | Bacteria | 3283 |
| 74 | Ga0466726_097980 | 3300042619 | Bacteria | 2571 |
| 75 | Ga0466726_427978 | 3300042619 | Bacteria | 2043 |
| 76 | Ga0466733_074294 | 3300042659 | Bacteria | 93274 |
| 77 | Ga0123353_10051001 | 3300010167 | Bacteria | 6601 |
| 78 | Ga0466713_115352 | 3300042602 | Bacteria | 29236 |
| 79 | Ga0466713_156527 | 3300042602 | Bacteria | 3915 |
| 80 | Ga0466716_173848 | 3300042605 | Bacteria | 43531 |
| 81 | Ga0466719_119564 | 3300042606 | Bacteria | 14100 |
| 82 | Ga0466719_146117 | 3300042606 | Bacteria | 1825 |
| 83 | Ga0466694_155148 | 3300042594 | Bacteria | 33595 |
| 84 | Ga0466696_080636 | 3300042596 | Bacteria | 10674 |
| 85 | Ga0466696_083196 | 3300042596 | Bacteria | 7799 |
| 86 | Ga0466705_229487 | 3300042612 | Bacteria | 9029 |
| 87 | Ga0466703_014879 | 3300042636 | Bacteria | 9207 |
| 88 | Ga0466703_297833 | 3300042636 | Bacteria | 1937 |
| 89 | Ga0466715_092390 | 3300042616 | Bacteria | 8687 |
| 90 | Ga0466715_117066 | 3300042616 | Bacteria | 10570 |
| 91 | Ga0466715_262591 | 3300042616 | Bacteria | 13449 |
| 92 | Ga0466715_505316 | 3300042616 | Bacteria | 4231 |
| 93 | Ga0466728_450217 | 3300042620 | Bacteria | 7769 |
| 94 | Ga0466722_004292 | 3300042609 | Bacteria | 12485 |
| 95 | Ga0466691_039484 | 3300042593 | Bacteria | 2638 |
| 96 | Ga0466696_022203 | 3300042596 | Bacteria | 14217 |
| 97 | JGI24702J35022_10001607 | 3300002462 | Bacteria | 13958 |
| 98 | Ga0466705_074875 | 3300042612 | Bacteria | 7147 |
| 99 | Ga0466735_038210 | 3300042624 | Bacteria | 5486 |
| 100 | Ga0466735_113511 | 3300042624 | Bacteria | 7473 |
| 101 | Ga0466735_157124 | 3300042624 | Bacteria | 1637 |
| 102 | Ga0466704_021545 | 3300042643 | Bacteria | 11269 |
| 103 | Ga0466704_037431 | 3300042643 | Bacteria | 18136 |
| 104 | Ga0466704_212927 | 3300042643 | Bacteria | 11858 |
| 105 | Ga0466727_014874 | 3300042655 | Bacteria | 3136 |
| 106 | Ga0466715_002824 | 3300042616 | Bacteria | 4668 |
| 107 | Ga0466723_078084 | 3300042618 | Bacteria | 4652 |
| 108 | Ga0466723_101273 | 3300042618 | Bacteria | 2584 |
| 109 | Ga0466723_165567 | 3300042618 | Bacteria | 20094 |
| 110 | Ga0466728_409675 | 3300042620 | Bacteria | 5348 |
| 111 | Ga0466713_002210 | 3300042602 | Bacteria | 6334 |
| 112 | Ga0466716_100090 | 3300042605 | Bacteria | 4538 |
| 113 | Ga0466690_161436 | 3300042590 | Bacteria | 18447 |
| 114 | Ga0466696_171156 | 3300042596 | Bacteria | 4650 |
| 115 | Ga0466696_350726 | 3300042596 | Bacteria | 10131 |
| 116 | IMNBL1DRAFT_c0012341 | 3300000062 | Bacteria | 3914 |
| 117 | Ga0068305_10066638 | 3300005083 | Bacteria | 13829 |
| 118 | Ga0466729_278325 | 3300042621 | Bacteria | 8029 |
| 119 | Ga0466735_104045 | 3300042624 | Bacteria | 2215 |
| 120 | Ga0466735_122133 | 3300042624 | Bacteria | 18547 |
| 121 | Ga0466703_024275 | 3300042636 | Bacteria | 27229 |
| 122 | Ga0466727_213061 | 3300042655 | Bacteria | 8411 |
| 123 | Ga0466715_181152 | 3300042616 | Bacteria | 7680 |
| 124 | Ga0466715_337385 | 3300042616 | Bacteria | 28368 |
| 125 | Ga0466728_481213 | 3300042620 | Bacteria | 2337 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.