Protein Family IF03869
Metagenome
Isolate
133
Members
69
Samples
115
Scaffolds
284.57
Avg Length
Representative Sequence
- ID
- 3300012839|Ga0160472_107155|Ga0160472_1071552
- Length
- 331 aa
- Sequence
- MQAGRDTRVIDLPGELLLPSPSSSGPCSPEDGADGDNPPMRIRFTKMQGAGNDFVVLDETRGTLGLAAAQYRFLADRHFGVGADQILTVRPSPAEGIDFQYVIHNADGGEVEQCGNGARCFMRFVRERGLTDKDAVRVQTLSGVIEPRMGADGRVTVDMGAPIFALPRVPFDAAGLDPVPSGGWQTWQLALDDQPDSSPVALAVLSMGNPHAVQLVADVDTAPVGTQGPLIEQHPRFPQRVNAGFMQIVDRGHVRLRVYERGAGETLACGTGACAAVVAGIRLGRLDTRVDVQTRGGLLSIEWAGGDAPVLMTGPAVTVFEGDIEIPDQP*
Sample Types
Isolate
13.5%
Metagenome
86.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
21.2%
Elmidae
16.7%
Formicidae
15.2%
Termitidae
13.6%
Unclassified
12.1%
Termopsidae
6.1%
Culicidae
6.1%
Rhinotermitidae
4.5%
Gryllidae
1.5%
Hodotermitidae
1.5%
Armadillidiidae
1.5%
Taxonomy
Archaea
0
Bacteria
126
Eukaryota
0
Viruses
0
Unclassified
7
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2864812326 | Chitinimonas taiwanensis S00057 | Isolate | Elmidae |
| 2 | 2864859030 | Chromobacterium alkanivorans S00115 | Isolate | Elmidae |
| 3 | 2864960361 | Comamonas odontotermitis S00229 | Isolate | Elmidae |
| 4 | 2868169047 | Comamonas aquatica S00077 | Isolate | Elmidae |
| 5 | 3300012809 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG | Metagenome | |
| 6 | 2687453756 | Pseudomonadales bacterium Cag32 | Isolate | Unclassified |
| 7 | 3000478755 | Entomomonas asaccharolytica F2A | Isolate | Gryllidae |
| 8 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 9 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 10 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 11 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 12 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 13 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 14 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 15 | 2864914039 | Chromobacterium alkanivorans S00172 | Isolate | Elmidae |
| 16 | 2864988360 | Chromobacterium alkanivorans S00296 | Isolate | Elmidae |
| 17 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 18 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 19 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 20 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 21 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 22 | 2864808494 | Chitinimonas taiwanensis S00056 | Isolate | Elmidae |
| 23 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 24 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 25 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 26 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 27 | 2864755708 | Massilia timonae S00006 | Isolate | Elmidae |
| 28 | 2687453754 | Pseudomonadales bacterium Cag26 | Isolate | Unclassified |
| 29 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 30 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 31 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 32 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 33 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 34 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 35 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 36 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 37 | 2864870719 | Comamonas odontotermitis S00124 | Isolate | Elmidae |
| 38 | 2864937364 | Acidovorax soli S00198 | Isolate | Elmidae |
| 39 | 2891720358 | Azoarcus nasutitermitis CC-YHH838 | Isolate | Unclassified |
| 40 | 2603880173 | Pseudomonas SP. | Isolate | Unclassified |
| 41 | 2687453755 | Pseudomonadales bacterium Cag27 | Isolate | Unclassified |
| 42 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 43 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 44 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 45 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 46 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 47 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 48 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 49 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 50 | 2864826666 | Acidovorax konjaci S00067 | Isolate | Elmidae |
| 51 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 52 | 3300002934 | Ant worker gut metagenome for colony PL005 | Metagenome | Formicidae |
| 53 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 54 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 55 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 56 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 57 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 58 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 59 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 60 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 61 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 62 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 63 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 64 | 2820639607 | Unclassified Firmicutes Cu122P5bin9 | Isolate | Unclassified |
| 65 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 66 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 67 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 68 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 69 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0068302_10062092 | 3300005071 | Bacteria | 5452 |
| 2 | Ga0103266_1000042 | 3300007067 | Bacteria | 115372 |
| 3 | Ga0102735_1000003 | 3300007080 | Bacteria | 119358 |
| 4 | Ga0466690_059308 | 3300042590 | Bacteria | 2865 |
| 5 | Ga0466722_157824 | 3300042609 | Bacteria | 2520 |
| 6 | Ga0466723_117871 | 3300042618 | Bacteria | 16620 |
| 7 | Ga0466704_499766 | 3300042643 | Bacteria | 1636 |
| 8 | Ga0466724_04402 | 3300042649 | Bacteria | 1601 |
| 9 | Ga0466708_078115 | 3300042652 | Bacteria | 10501 |
| 10 | Ga0466708_340344 | 3300042652 | Bacteria | 7098 |
| 11 | Ga0102734_1000437 | 3300007129 | Bacteria | 12018 |
| 12 | Ga0102734_1000546 | 3300007129 | Bacteria | 19972 |
| 13 | Ga0160470_100954 | 3300012813 | Bacteria | 8225 |
| 14 | Ga0160447_105952 | 3300012849 | Bacteria | 3292 |
| 15 | Ga0466690_405819 | 3300042590 | Bacteria | 18442 |
| 16 | Ga0466701_039976 | 3300042598 | Bacteria | 327114 |
| 17 | Ga0466706_042829 | 3300042599 | Bacteria | 8537 |
| 18 | Ga0466706_052481 | 3300042599 | Bacteria | 20425 |
| 19 | Ga0466706_261600 | 3300042599 | Bacteria | 22200 |
| 20 | Ga0466707_297240 | 3300042601 | Bacteria | 5968 |
| 21 | Ga0466713_085368 | 3300042602 | Bacteria | 2770 |
| 22 | Ga0466715_072058 | 3300042616 | Bacteria | 5834 |
| 23 | Ga0466723_014509 | 3300042618 | Bacteria | 63718 |
| 24 | Ga0466728_413929 | 3300042620 | Bacteria | 8298 |
| 25 | Ga0466735_158041 | 3300042624 | Bacteria | 2758 |
| 26 | Ga0466703_326019 | 3300042636 | Bacteria | 3185 |
| 27 | Ga0466727_074891 | 3300042655 | Bacteria | 85958 |
| 28 | Ga0102737_1001630 | 3300007142 | Bacteria | 6094 |
| 29 | Ga0160466_101212 | 3300012809 | Unclassified | 7860 |
| 30 | Ga0160470_100032 | 3300012813 | Bacteria | 210853 |
| 31 | Ga0160447_107626 | 3300012849 | Unclassified | 2683 |
| 32 | Ga0466657_132774 | 3300042582 | Bacteria | 2737 |
| 33 | Ga0466690_040762 | 3300042590 | Bacteria | 15815 |
| 34 | Ga0466693_204246 | 3300042592 | Bacteria | 1759 |
| 35 | Ga0466701_083241 | 3300042598 | Bacteria | 1440 |
| 36 | Ga0466719_195901 | 3300042606 | Bacteria | 1020 |
| 37 | Ga0466722_214208 | 3300042609 | Bacteria | 6634 |
| 38 | Ga0466711_437442 | 3300042615 | Bacteria | 8235 |
| 39 | Ga0466723_231763 | 3300042618 | Bacteria | 9332 |
| 40 | Ga0466726_049422 | 3300042619 | Bacteria | 2394 |
| 41 | Ga0466729_015988 | 3300042621 | Bacteria | 35530 |
| 42 | Ga0466734_148375 | 3300042623 | Bacteria | 4407 |
| 43 | Ga0466730_048082 | 3300042625 | Bacteria | 16591 |
| 44 | Ga0466724_25034 | 3300042649 | Bacteria | 837337 |
| 45 | Ga0466708_288313 | 3300042652 | Bacteria | 4844 |
| 46 | Ga0160472_107155 | 3300012839 | Bacteria | 1592 |
| 47 | Ga0466692_053391 | 3300042591 | Bacteria | 21085 |
| 48 | Ga0466696_319166 | 3300042596 | Bacteria | 3517 |
| 49 | Ga0466696_449654 | 3300042596 | Bacteria | 6584 |
| 50 | Ga0466719_055829 | 3300042606 | Bacteria | 6141 |
| 51 | Ga0466705_457204 | 3300042612 | Bacteria | 1779 |
| 52 | Ga0466711_201256 | 3300042615 | Bacteria | 33211 |
| 53 | Ga0466715_569877 | 3300042616 | Bacteria | 5890 |
| 54 | Ga0466726_165393 | 3300042619 | Bacteria | 22745 |
| 55 | Ga0466703_037265 | 3300042636 | Bacteria | 1632 |
| 56 | Ga0466703_054918 | 3300042636 | Bacteria | 10839 |
| 57 | Ga0466709_080472 | 3300042648 | Bacteria | 1490 |
| 58 | Ga0466708_296884 | 3300042652 | Bacteria | 11410 |
| 59 | CVPL010W_10000724 | 3300002931 | Bacteria | 36746 |
| 60 | Ga0103268_1000048 | 3300007192 | Bacteria | 56515 |
| 61 | Ga0160447_103190 | 3300012849 | Bacteria | 5361 |
| 62 | Ga0466691_012703 | 3300042593 | Bacteria | 6388 |
| 63 | Ga0466706_235211 | 3300042599 | Bacteria | 2198 |
| 64 | Ga0466713_041366 | 3300042602 | Bacteria | 9753 |
| 65 | Ga0466716_372558 | 3300042605 | Bacteria | 5666 |
| 66 | Ga0466710_024444 | 3300042613 | Bacteria | 92422 |
| 67 | Ga0466710_230433 | 3300042613 | Bacteria | 1867 |
| 68 | Ga0466703_284619 | 3300042636 | Bacteria | 67055 |
| 69 | Ga0466709_007718 | 3300042648 | Bacteria | 17770 |
| 70 | Ga0466709_386465 | 3300042648 | Bacteria | 4112 |
| 71 | Ga0466724_29068 | 3300042649 | Unclassified | 21450 |
| 72 | Ga0103264_1000314 | 3300007188 | Bacteria | 29752 |
| 73 | Ga0466705_091155 | 3300042612 | Bacteria | 29389 |
| 74 | Ga0466705_222000 | 3300042612 | Unclassified | 1948 |
| 75 | Ga0160444_100192 | 3300012841 | Bacteria | 55650 |
| 76 | Ga0466722_217532 | 3300042609 | Bacteria | 5183 |
| 77 | Ga0466722_225405 | 3300042609 | Bacteria | 9878 |
| 78 | Ga0466729_130971 | 3300042621 | Bacteria | 7044 |
| 79 | Ga0466734_140524 | 3300042623 | Bacteria | 4341 |
| 80 | Ga0466735_097890 | 3300042624 | Bacteria | 2821 |
| 81 | Ga0466730_043065 | 3300042625 | Bacteria | 98730 |
| 82 | Ga0466704_304785 | 3300042643 | Unclassified | 1510 |
| 83 | Ga0466708_130429 | 3300042652 | Bacteria | 31456 |
| 84 | Ga0466708_193130 | 3300042652 | Bacteria | 28428 |
| 85 | Ga0102734_1028084 | 3300007129 | Bacteria | 1438 |
| 86 | Ga0103267_1000044 | 3300007190 | Bacteria | 93277 |
| 87 | Ga0123354_10228195 | 3300010882 | Bacteria | 1955 |
| 88 | Ga0466705_063190 | 3300042612 | Bacteria | 1433 |
| 89 | Ga0160453_102532 | 3300012814 | Bacteria | 4422 |
| 90 | Ga0466657_258496 | 3300042582 | Bacteria | 2504 |
| 91 | Ga0466717_272087 | 3300042604 | Bacteria | 1946 |
| 92 | Ga0466719_184984 | 3300042606 | Bacteria | 3299 |
| 93 | Ga0466722_267049 | 3300042609 | Bacteria | 1333 |
| 94 | Ga0466728_274563 | 3300042620 | Bacteria | 5444 |
| 95 | Ga0466703_188386 | 3300042636 | Bacteria | 18424 |
| 96 | Ga0466704_045955 | 3300042643 | Bacteria | 3179 |
| 97 | CVPL005W_1000066 | 3300002934 | Bacteria | 47403 |
| 98 | Ga0102736_1000743 | 3300007052 | Bacteria | 6192 |
| 99 | Ga0160441_100095 | 3300012825 | Bacteria | 104863 |
| 100 | Ga0160435_1001190 | 3300012857 | Unclassified | 6775 |
| 101 | Ga0466657_070885 | 3300042582 | Bacteria | 103407 |
| 102 | Ga0466690_227357 | 3300042590 | Bacteria | 66582 |
| 103 | Ga0466692_196381 | 3300042591 | Bacteria | 18113 |
| 104 | Ga0466691_077613 | 3300042593 | Bacteria | 22867 |
| 105 | Ga0466696_365385 | 3300042596 | Bacteria | 12927 |
| 106 | Ga0466701_024971 | 3300042598 | Unclassified | 1484 |
| 107 | Ga0466706_074030 | 3300042599 | Bacteria | 2985 |
| 108 | Ga0466706_088277 | 3300042599 | Bacteria | 16625 |
| 109 | Ga0466706_190635 | 3300042599 | Bacteria | 1555 |
| 110 | Ga0466716_110796 | 3300042605 | Bacteria | 1483 |
| 111 | Ga0466722_237040 | 3300042609 | Bacteria | 3164 |
| 112 | Ga0466715_239526 | 3300042616 | Bacteria | 2708 |
| 113 | Ga0466729_108822 | 3300042621 | Bacteria | 1255 |
| 114 | Ga0466729_126749 | 3300042621 | Bacteria | 1142 |
| 115 | Ga0466724_55066 | 3300042649 | Bacteria | 4402 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01678 | DAP_epimerase | Diaminopimelate epimerase | 205 | 318 | 0.96 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.