Protein Family IF03865
Metagenome
Isolate
126
Members
54
Samples
123
Scaffolds
126.96
Avg Length
Representative Sequence
- ID
- 3300012839|Ga0160472_102494|Ga0160472_1024943
- Length
- 143 aa
- Sequence
- VRNGLASNLCLDQLSLEPTMTLKYTKDHEWVLADGGIATVGITVHAQDALGDVVFVDLPEVGKRFASGEVAGVVESVKAAADVFMPVSGEITEVNEALRADPSLANSDPLASGWFFKVKLSNAAEVDALMDATSYEKFSEQA*
Sample Types
Isolate
2.4%
Metagenome
97.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
39.2%
Kalotermitidae
27.5%
Culicidae
9.8%
Unclassified
5.9%
Termopsidae
5.9%
Rhinotermitidae
3.9%
Formicidae
2.0%
Hodotermitidae
2.0%
Armadillidiidae
2.0%
Elmidae
2.0%
Taxonomy
Archaea
0
Bacteria
117
Eukaryota
0
Viruses
0
Unclassified
9
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125629 | Treponema sp. Nt197P3bin20 | Isolate | Unclassified |
| 2 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 3 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 4 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 5 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 6 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 7 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 8 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 9 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 10 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 11 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 12 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 13 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 14 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 15 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 16 | 2781125630 | Treponema sp. Nt197P3bin60 | Isolate | Unclassified |
| 17 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 18 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 19 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 20 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 21 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 22 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 23 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 24 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 25 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 26 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 27 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 28 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 29 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 30 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 31 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 32 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 33 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 34 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 35 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 36 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 37 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 38 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 39 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 40 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 41 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 42 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 43 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 44 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 45 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 46 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 47 | 2864968865 | Paucibacter oligotrophus S00239 | Isolate | Elmidae |
| 48 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 49 | 3300012803 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG | Metagenome | |
| 50 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 51 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 52 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 53 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 54 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_074901 | 3300042612 | Bacteria | 39193 |
| 2 | Ga0466691_151842 | 3300042593 | Bacteria | 33363 |
| 3 | Ga0466695_220425 | 3300042595 | Bacteria | 4179 |
| 4 | Ga0466708_231264 | 3300042652 | Bacteria | 8144 |
| 5 | Ga0466727_339340 | 3300042655 | Unclassified | 1162 |
| 6 | Ga0466705_487337 | 3300042612 | Bacteria | 6717 |
| 7 | Ga0466723_149373 | 3300042618 | Bacteria | 11106 |
| 8 | Ga0466706_166079 | 3300042599 | Bacteria | 24785 |
| 9 | Ga0466706_260102 | 3300042599 | Bacteria | 1903 |
| 10 | Ga0466722_022867 | 3300042609 | Bacteria | 2019 |
| 11 | Ga0466722_072040 | 3300042609 | Bacteria | 5237 |
| 12 | Ga0466722_108310 | 3300042609 | Bacteria | 20847 |
| 13 | Ga0466722_167195 | 3300042609 | Bacteria | 9094 |
| 14 | Ga0466722_203304 | 3300042609 | Bacteria | 3508 |
| 15 | JGI24705J35276_11334042 | 3300002504 | Bacteria | 510 |
| 16 | Ga0160459_100395 | 3300012831 | Bacteria | 18203 |
| 17 | Ga0160435_1013616 | 3300012857 | Bacteria | 1602 |
| 18 | Ga0466657_313649 | 3300042582 | Bacteria | 1181 |
| 19 | Ga0466692_137805 | 3300042591 | Bacteria | 8693 |
| 20 | Ga0466693_426648 | 3300042592 | Bacteria | 1551 |
| 21 | Ga0466734_062671 | 3300042623 | Bacteria | 1297 |
| 22 | Ga0466709_414581 | 3300042648 | Bacteria | 5756 |
| 23 | Ga0466724_52883 | 3300042649 | Bacteria | 459297 |
| 24 | Ga0466708_176123 | 3300042652 | Bacteria | 10260 |
| 25 | Ga0466708_262291 | 3300042652 | Unclassified | 1004 |
| 26 | Ga0466723_136564 | 3300042618 | Bacteria | 5988 |
| 27 | Ga0466723_141783 | 3300042618 | Bacteria | 2105 |
| 28 | Ga0466728_206199 | 3300042620 | Bacteria | 3178 |
| 29 | Ga0466713_137451 | 3300042602 | Bacteria | 2109 |
| 30 | Ga0466717_129772 | 3300042604 | Bacteria | 15738 |
| 31 | AustNasuHG_c1066024 | 3300000089 | Bacteria | 674 |
| 32 | CVPL010W_10013058 | 3300002931 | Bacteria | 6431 |
| 33 | Ga0466732_449585 | 3300042656 | Bacteria | 1312 |
| 34 | Ga0466733_089910 | 3300042659 | Bacteria | 1397 |
| 35 | Ga0466733_116442 | 3300042659 | Bacteria | 1429 |
| 36 | Ga0466657_365866 | 3300042582 | Bacteria | 1211 |
| 37 | Ga0466693_415496 | 3300042592 | Bacteria | 1768 |
| 38 | Ga0466731_380791 | 3300042622 | Bacteria | 3423 |
| 39 | Ga0466725_267511 | 3300042654 | Bacteria | 13384 |
| 40 | Ga0466726_047329 | 3300042619 | Bacteria | 9614 |
| 41 | Ga0466716_446081 | 3300042605 | Bacteria | 3697 |
| 42 | Ga0466719_551553 | 3300042606 | Bacteria | 1253 |
| 43 | Ga0466705_071742 | 3300042612 | Bacteria | 5105 |
| 44 | Ga0466705_093826 | 3300042612 | Bacteria | 8564 |
| 45 | Ga0160456_101535 | 3300012820 | Bacteria | 5281 |
| 46 | Ga0160472_103078 | 3300012839 | Bacteria | 3454 |
| 47 | Ga0466690_304604 | 3300042590 | Bacteria | 1252 |
| 48 | Ga0466693_171827 | 3300042592 | Unclassified | 1150 |
| 49 | Ga0466691_221913 | 3300042593 | Bacteria | 2871 |
| 50 | Ga0466708_065719 | 3300042652 | Bacteria | 27310 |
| 51 | Ga0466715_086412 | 3300042616 | Bacteria | 13951 |
| 52 | Ga0466715_174156 | 3300042616 | Bacteria | 1518 |
| 53 | Ga0466723_191174 | 3300042618 | Bacteria | 3158 |
| 54 | Ga0123353_10774383 | 3300010167 | Bacteria | 1330 |
| 55 | Ga0466719_109102 | 3300042606 | Bacteria | 7652 |
| 56 | JGI24702J35022_10150461 | 3300002462 | Bacteria | 1305 |
| 57 | Ga0466705_143754 | 3300042612 | Bacteria | 2655 |
| 58 | Ga0466733_106655 | 3300042659 | Bacteria | 1747 |
| 59 | Ga0466733_111817 | 3300042659 | Bacteria | 4461 |
| 60 | Ga0160452_100034 | 3300012834 | Bacteria | 214802 |
| 61 | Ga0160446_109682 | 3300012835 | Bacteria | 1242 |
| 62 | Ga0160472_102494 | 3300012839 | Bacteria | 4119 |
| 63 | Ga0160435_1009727 | 3300012857 | Unclassified | 2028 |
| 64 | Ga0466693_193267 | 3300042592 | Bacteria | 3350 |
| 65 | Ga0466703_125781 | 3300042636 | Bacteria | 4056 |
| 66 | Ga0466727_227095 | 3300042655 | Bacteria | 1220 |
| 67 | Ga0466715_519275 | 3300042616 | Bacteria | 1005 |
| 68 | Ga0466715_521847 | 3300042616 | Bacteria | 2645 |
| 69 | Ga0466718_103495 | 3300042617 | Bacteria | 1285 |
| 70 | Ga0466726_339446 | 3300042619 | Bacteria | 4555 |
| 71 | Ga0160465_108279 | 3300012803 | Bacteria | 976 |
| 72 | Ga0466701_083644 | 3300042598 | Bacteria | 1922 |
| 73 | Ga0466719_032540 | 3300042606 | Bacteria | 13008 |
| 74 | JGI24698J34947_10071435 | 3300002449 | Bacteria | 1666 |
| 75 | JGI24702J35022_10247394 | 3300002462 | Bacteria | 1036 |
| 76 | Ga0466733_002803 | 3300042659 | Bacteria | 38582 |
| 77 | Ga0160430_105527 | 3300012852 | Bacteria | 2886 |
| 78 | Ga0466690_156854 | 3300042590 | Bacteria | 9950 |
| 79 | Ga0466731_290462 | 3300042622 | Bacteria | 6100 |
| 80 | Ga0466734_083297 | 3300042623 | Bacteria | 1409 |
| 81 | Ga0466708_097357 | 3300042652 | Bacteria | 3852 |
| 82 | Ga0466708_172738 | 3300042652 | Bacteria | 4634 |
| 83 | Ga0466708_217102 | 3300042652 | Bacteria | 6631 |
| 84 | Ga0466715_394022 | 3300042616 | Bacteria | 3898 |
| 85 | Ga0466728_164082 | 3300042620 | Bacteria | 18715 |
| 86 | Ga0466717_126885 | 3300042604 | Bacteria | 2111 |
| 87 | Ga0466733_134114 | 3300042659 | Bacteria | 2406 |
| 88 | Ga0466733_141574 | 3300042659 | Bacteria | 39609 |
| 89 | Ga0160436_1022852 | 3300012861 | Unclassified | 1158 |
| 90 | Ga0466692_189276 | 3300042591 | Bacteria | 6300 |
| 91 | Ga0466696_161763 | 3300042596 | Bacteria | 1438 |
| 92 | Ga0466734_085917 | 3300042623 | Bacteria | 5714 |
| 93 | Ga0466735_206718 | 3300042624 | Bacteria | 2337 |
| 94 | Ga0466704_043012 | 3300042643 | Unclassified | 3982 |
| 95 | Ga0466704_047715 | 3300042643 | Bacteria | 5670 |
| 96 | Ga0466704_081162 | 3300042643 | Bacteria | 14166 |
| 97 | Ga0466704_457484 | 3300042643 | Bacteria | 17915 |
| 98 | Ga0466724_27654 | 3300042649 | Bacteria | 76646 |
| 99 | Ga0466708_016527 | 3300042652 | Bacteria | 4946 |
| 100 | Ga0466725_248212 | 3300042654 | Bacteria | 4043 |
| 101 | Ga0466710_339683 | 3300042613 | Bacteria | 1134 |
| 102 | Ga0466726_223434 | 3300042619 | Bacteria | 1505 |
| 103 | Ga0123354_10036328 | 3300010882 | Bacteria | 7685 |
| 104 | Ga0466700_360003 | 3300042600 | Bacteria | 1567 |
| 105 | Ga0466716_239002 | 3300042605 | Bacteria | 2843 |
| 106 | Ga0466719_430635 | 3300042606 | Bacteria | 8667 |
| 107 | Ga0466722_064378 | 3300042609 | Unclassified | 1027 |
| 108 | Ga0466722_247054 | 3300042609 | Bacteria | 3169 |
| 109 | JGI24705J35276_12108241 | 3300002504 | Unclassified | 1036 |
| 110 | Ga0466733_118132 | 3300042659 | Bacteria | 16343 |
| 111 | Ga0466657_305284 | 3300042582 | Bacteria | 1733 |
| 112 | Ga0466696_327456 | 3300042596 | Bacteria | 4262 |
| 113 | Ga0466734_065234 | 3300042623 | Bacteria | 5707 |
| 114 | Ga0466703_289470 | 3300042636 | Bacteria | 7357 |
| 115 | Ga0466703_291127 | 3300042636 | Bacteria | 20746 |
| 116 | Ga0466703_303518 | 3300042636 | Bacteria | 3265 |
| 117 | Ga0466710_273701 | 3300042613 | Bacteria | 2679 |
| 118 | Ga0466711_068849 | 3300042615 | Bacteria | 12699 |
| 119 | Ga0466726_429408 | 3300042619 | Bacteria | 4179 |
| 120 | Ga0466701_020889 | 3300042598 | Unclassified | 1775 |
| 121 | Ga0466717_125908 | 3300042604 | Bacteria | 1028 |
| 122 | Ga0466716_243185 | 3300042605 | Bacteria | 9864 |
| 123 | Ga0466719_353664 | 3300042606 | Bacteria | 4631 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01597 | GCV_H | Glycine cleavage H-protein | 22 | 140 | 0.98 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.