Protein Family IF03667
Metagenome
Isolate
134
Members
73
Samples
112
Scaffolds
229
Avg Length
Representative Sequence
- ID
- 3300012814|Ga0160453_100350|Ga0160453_10035032
- Length
- 262 aa
- Sequence
- MKLSLENIKEGRMNMANLVEQNLTTLRREMELACLASGREISEVKLLLATKTVPLEKLQLALQVGETLFGENKVQELRDKFPLMQQYNQLEWHFIGHLQTNKVKDVVKYVTLIHSVDRLKLGQVLHQYLLKENKTMDILVQVNTSCEESKFGISPQSVLELVDQLSQFDKLNIKGLMTIGKLGATNEETRQCFRRLKQLQTQIIEKKFPRVQMDILSMGMSGDFKIAIEEGATIIRVGTSIFGERYLPDEYYWNENANQNE*
Sample Types
Isolate
16.4%
Metagenome
83.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
35.7%
Kalotermitidae
20.0%
Unclassified
17.1%
Blattidae
11.4%
Rhinotermitidae
2.9%
Termopsidae
2.9%
Hydrophilidae
1.4%
Culicidae
1.4%
Armadillidiidae
1.4%
Apidae
1.4%
Passalidae
1.4%
Noctuidae
1.4%
Drosophilidae
1.4%
Taxonomy
Archaea
0
Bacteria
131
Eukaryota
0
Viruses
0
Unclassified
3
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820106212 | Unclassified Proteobacteria Emb289P4bin44 | Isolate | Unclassified |
| 2 | 2820641689 | Unclassified Firmicutes Cu122P5bin5 | Isolate | Unclassified |
| 3 | 2873776654 | Pedobacter sp. HDW13 | Isolate | Hydrophilidae |
| 4 | 2940406939 | Paenibacillus sp. PastM-3 | Isolate | Blattidae |
| 5 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 6 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 7 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 8 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 9 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 10 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 11 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 12 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 13 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 14 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 15 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 16 | 2820755292 | Unclassified Bacteroidetes Nc150P3bin3 | Isolate | Unclassified |
| 17 | 2758568796 | Unclassified Deltaproteobacteria Th196P3_bin21 | Isolate | Unclassified |
| 18 | 2820215626 | Unclassified Kiritimatiellaeota Nt197P3bin123 | Isolate | Unclassified |
| 19 | 2940425923 | Paenibacillus sp. PastH-4 | Isolate | Blattidae |
| 20 | 2983866074 | Paenibacillus polymyxa A18 | Isolate | Unclassified |
| 21 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 22 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 23 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 24 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 25 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 26 | 2524614537 | Lysinibacillus sphaericus OT4b.31 | Isolate | Unclassified |
| 27 | 2940386776 | Paenibacillus sp. PastF-1 | Isolate | Blattidae |
| 28 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 29 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 30 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 31 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 32 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 33 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 34 | 2820547636 | Unclassified Firmicutes Lab288P1bin10 | Isolate | Unclassified |
| 35 | 2940393498 | Paenibacillus sp. PastF-2 | Isolate | Blattidae |
| 36 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 37 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 38 | 2827179085 | Paenibacillus alvei DSM 29 | Isolate | Apidae |
| 39 | 2940419646 | Paenibacillus sp. PastF-4 | Isolate | Blattidae |
| 40 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 41 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 42 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 43 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 44 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 45 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 46 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 47 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 48 | 2820111668 | Unclassified Proteobacteria Emb289P4bin34 | Isolate | Unclassified |
| 49 | 2940380068 | Paenibacillus sp. PastH-2 | Isolate | Blattidae |
| 50 | 2940413413 | Paenibacillus sp. PastH-3 | Isolate | Blattidae |
| 51 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 52 | 3300012809 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG | Metagenome | |
| 53 | 2940400224 | Paenibacillus sp. PastM-2 | Isolate | Blattidae |
| 54 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 55 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 56 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 57 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 58 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 59 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 60 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 61 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 62 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 63 | 2551306396 | Paenibacillus sp. ICGEB2008 | Isolate | Noctuidae |
| 64 | 2820110010 | Unclassified Proteobacteria Emb289P4bin35 | Isolate | Unclassified |
| 65 | 2820753519 | Unclassified Bacteroidetes Nc150P4bin20 | Isolate | Unclassified |
| 66 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 67 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 68 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 69 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 70 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 71 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 72 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 73 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_273242 | 3300042612 | Bacteria | 11729 |
| 2 | Ga0466705_500814 | 3300042612 | Bacteria | 28836 |
| 3 | Ga0466711_453482 | 3300042615 | Bacteria | 1302 |
| 4 | Ga0466723_235996 | 3300042618 | Bacteria | 8944 |
| 5 | Ga0123356_10293995 | 3300010049 | Bacteria | 1726 |
| 6 | Ga0123356_11013585 | 3300010049 | Bacteria | 1000 |
| 7 | Ga0123353_10392137 | 3300010167 | Bacteria | 2071 |
| 8 | Ga0466701_035767 | 3300042598 | Bacteria | 128967 |
| 9 | Ga0466719_076075 | 3300042606 | Bacteria | 3441 |
| 10 | Ga0466721_184634 | 3300042608 | Bacteria | 2122 |
| 11 | Ga0466722_072401 | 3300042609 | Bacteria | 13246 |
| 12 | Ga0466698_315075 | 3300042610 | Bacteria | 1975 |
| 13 | Ga0160453_100350 | 3300012814 | Bacteria | 39506 |
| 14 | Ga0415639_195224 | 3300038395 | Bacteria | 4030 |
| 15 | Ga0466705_383677 | 3300042612 | Bacteria | 2682 |
| 16 | Ga0466705_481115 | 3300042612 | Bacteria | 54627 |
| 17 | Ga0466715_099998 | 3300042616 | Bacteria | 20690 |
| 18 | Ga0466715_279396 | 3300042616 | Bacteria | 2038 |
| 19 | Ga0466715_285516 | 3300042616 | Bacteria | 10439 |
| 20 | Ga0466723_043308 | 3300042618 | Bacteria | 6343 |
| 21 | Ga0466723_287335 | 3300042618 | Bacteria | 21779 |
| 22 | Ga0466723_367555 | 3300042618 | Bacteria | 11651 |
| 23 | Ga0466726_340762 | 3300042619 | Bacteria | 3788 |
| 24 | Ga0123353_10165189 | 3300010167 | Bacteria | 3519 |
| 25 | Ga0466700_238039 | 3300042600 | Bacteria | 3628 |
| 26 | Ga0466657_016832 | 3300042582 | Bacteria | 2273 |
| 27 | Ga0466690_137464 | 3300042590 | Bacteria | 4247 |
| 28 | Ga0466693_374623 | 3300042592 | Bacteria | 1306 |
| 29 | Ga0466697_092531 | 3300042611 | Bacteria | 1779 |
| 30 | Ga0466705_118471 | 3300042612 | Bacteria | 5323 |
| 31 | Ga0466723_077295 | 3300042618 | Bacteria | 10580 |
| 32 | Ga0123355_10000089 | 3300009826 | Bacteria | 96529 |
| 33 | Ga0123353_10173715 | 3300010167 | Bacteria | 3418 |
| 34 | Ga0466709_292477 | 3300042648 | Bacteria | 5578 |
| 35 | JGI24698J34947_10010929 | 3300002449 | Bacteria | 4980 |
| 36 | JGI24698J34947_10080195 | 3300002449 | Unclassified | 1534 |
| 37 | JGI24695J34938_10049270 | 3300002450 | Bacteria | 1852 |
| 38 | JGI24702J35022_10001828 | 3300002462 | Bacteria | 13099 |
| 39 | Ga0466700_440816 | 3300042600 | Bacteria | 1848 |
| 40 | Ga0466717_162587 | 3300042604 | Bacteria | 3917 |
| 41 | Ga0466716_092166 | 3300042605 | Bacteria | 1468 |
| 42 | Ga0466705_256487 | 3300042612 | Bacteria | 125039 |
| 43 | Ga0466733_201141 | 3300042659 | Bacteria | 8038 |
| 44 | Ga0466705_458442 | 3300042612 | Bacteria | 7090 |
| 45 | Ga0466710_021228 | 3300042613 | Bacteria | 41506 |
| 46 | Ga0466723_217856 | 3300042618 | Bacteria | 8531 |
| 47 | Ga0466723_271571 | 3300042618 | Bacteria | 1151 |
| 48 | Ga0466728_104651 | 3300042620 | Bacteria | 4240 |
| 49 | Ga0466729_166579 | 3300042621 | Bacteria | 2394 |
| 50 | Ga0123354_10262068 | 3300010882 | Bacteria | 1723 |
| 51 | Ga0466703_393525 | 3300042636 | Bacteria | 72819 |
| 52 | Ga0466704_091891 | 3300042643 | Bacteria | 6166 |
| 53 | IMNBGM34_c000689 | 3300000036 | Bacteria | 8137 |
| 54 | JGI24702J35022_10018107 | 3300002462 | Bacteria | 3844 |
| 55 | Ga0072940_1065882 | 3300005200 | Bacteria | 3930 |
| 56 | Ga0105005_1025498 | 3300007505 | Bacteria | 5607 |
| 57 | Ga0123357_10000836 | 3300009784 | Bacteria | 31243 |
| 58 | Ga0466707_129172 | 3300042601 | Bacteria | 4139 |
| 59 | Ga0466714_000287 | 3300042603 | Bacteria | 5423 |
| 60 | Ga0466717_011444 | 3300042604 | Bacteria | 2458 |
| 61 | Ga0466719_368744 | 3300042606 | Bacteria | 25583 |
| 62 | Ga0466722_183668 | 3300042609 | Bacteria | 4823 |
| 63 | Ga0466690_389304 | 3300042590 | Bacteria | 3314 |
| 64 | Ga0466715_225720 | 3300042616 | Bacteria | 14185 |
| 65 | Ga0466718_020883 | 3300042617 | Bacteria | 1644 |
| 66 | Ga0466723_098598 | 3300042618 | Bacteria | 2666 |
| 67 | Ga0466723_250433 | 3300042618 | Bacteria | 5758 |
| 68 | Ga0466723_344666 | 3300042618 | Bacteria | 4482 |
| 69 | Ga0466735_118102 | 3300042624 | Bacteria | 26562 |
| 70 | Ga0466703_246048 | 3300042636 | Bacteria | 6181 |
| 71 | Ga0466704_594161 | 3300042643 | Bacteria | 15028 |
| 72 | Ga0466707_088010 | 3300042601 | Bacteria | 5232 |
| 73 | Ga0466722_190607 | 3300042609 | Bacteria | 13141 |
| 74 | Ga0466698_385525 | 3300042610 | Bacteria | 4026 |
| 75 | Ga0415639_139949 | 3300038395 | Bacteria | 1780 |
| 76 | Ga0466691_051496 | 3300042593 | Bacteria | 20198 |
| 77 | Ga0466726_219540 | 3300042619 | Bacteria | 2733 |
| 78 | Ga0466728_481466 | 3300042620 | Bacteria | 1359 |
| 79 | Ga0123355_10055601 | 3300009826 | Bacteria | 6407 |
| 80 | Ga0123356_10038738 | 3300010049 | Bacteria | 4441 |
| 81 | Ga0123353_10358355 | 3300010167 | Bacteria | 2193 |
| 82 | Ga0160466_100934 | 3300012809 | Bacteria | 10353 |
| 83 | Ga0466731_434012 | 3300042622 | Bacteria | 1501 |
| 84 | Ga0466735_058344 | 3300042624 | Bacteria | 1501 |
| 85 | Ga0466708_062858 | 3300042652 | Bacteria | 11796 |
| 86 | Ga0466716_349587 | 3300042605 | Bacteria | 1713 |
| 87 | Ga0466732_365083 | 3300042656 | Bacteria | 3466 |
| 88 | Ga0466718_064991 | 3300042617 | Unclassified | 2228 |
| 89 | Ga0123355_10000005 | 3300009826 | Bacteria | 212958 |
| 90 | Ga0123356_10591041 | 3300010049 | Bacteria | 1274 |
| 91 | Ga0466703_045996 | 3300042636 | Bacteria | 4598 |
| 92 | Ga0123357_10001422 | 3300009784 | Bacteria | 25377 |
| 93 | Ga0466701_079905 | 3300042598 | Bacteria | 1449 |
| 94 | Ga0466714_004323 | 3300042603 | Bacteria | 16717 |
| 95 | Ga0466722_010481 | 3300042609 | Bacteria | 1823 |
| 96 | Ga0160445_100580 | 3300012847 | Bacteria | 16258 |
| 97 | Ga0160448_110718 | 3300012854 | Bacteria | 1915 |
| 98 | Ga0415639_029080 | 3300038395 | Unclassified | 4569 |
| 99 | Ga0466696_020333 | 3300042596 | Bacteria | 15336 |
| 100 | Ga0466705_413959 | 3300042612 | Bacteria | 23585 |
| 101 | Ga0466715_547104 | 3300042616 | Bacteria | 25033 |
| 102 | Ga0466723_052549 | 3300042618 | Bacteria | 12057 |
| 103 | Ga0466729_215809 | 3300042621 | Bacteria | 18744 |
| 104 | JGI24702J35022_10204535 | 3300002462 | Bacteria | 1131 |
| 105 | JGI24705J35276_12231989 | 3300002504 | Bacteria | 4139 |
| 106 | Ga0123357_10000352 | 3300009784 | Bacteria | 43511 |
| 107 | Ga0466707_027215 | 3300042601 | Bacteria | 11213 |
| 108 | Ga0466714_168878 | 3300042603 | Bacteria | 2734 |
| 109 | Ga0466716_252663 | 3300042605 | Bacteria | 3291 |
| 110 | Ga0264413_129381 | 3300024493 | Bacteria | 4481 |
| 111 | Ga0415639_119889 | 3300038395 | Bacteria | 1285 |
| 112 | Ga0466691_065340 | 3300042593 | Bacteria | 14409 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01168 | Ala_racemase_N | Alanine racemase, N-terminal domain | 58 | 244 | 0.88 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.