Protein Family IF03558
Metagenome
Isolate
143
Members
42
Samples
140
Scaffolds
123.2
Avg Length
Representative Sequence
- ID
- 3300010882|Ga0123354_10738160|Ga0123354_107381602
- Length
- 128 aa
- Sequence
- MEYVYPAIFHKNQDESYTITYPDLPGCTSGGKTLGYAMYMAQSALTHWIGYLTDEKLEIPKATPIEEVTISEGDFVNLICAEVRDAKAVKRTVSIPKWMDDKAVQSDLSLSRVLQDALNEKLSDVQF*
Sample Types
Isolate
2.1%
Metagenome
97.9%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
62.5%
Kalotermitidae
22.5%
Unclassified
7.5%
Termopsidae
5.0%
Rhinotermitidae
2.5%
Taxonomy
Archaea
0
Bacteria
108
Eukaryota
0
Viruses
0
Unclassified
35
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 2 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 3 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 4 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 5 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 6 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 7 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 8 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 9 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 10 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 11 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 12 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 13 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 14 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 15 | 2820730639 | Unclassified Chloroflexi Th196P4bin31 | Isolate | Unclassified |
| 16 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 17 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 18 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 19 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 20 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 21 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 22 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 23 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 24 | 2820303403 | Unclassified Firmicutes Th196P1bin2 | Isolate | Unclassified |
| 25 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 26 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 27 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 28 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 29 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 30 | 2228664003 | P3 Gut Segment Termite Single Cell Genome_Treponema sp. T4b from Florida, USA | Metagenome | Termitidae |
| 31 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 32 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 33 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 34 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 35 | 2820021908 | Unclassified Spirochaetes Lab288P4bin6 | Isolate | Unclassified |
| 36 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 37 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 38 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 39 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 40 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 41 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 42 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_361288 | 3300042656 | Unclassified | 1496 |
| 2 | Ga0466712_138337 | 3300042614 | Bacteria | 5499 |
| 3 | Ga0466715_054105 | 3300042616 | Bacteria | 7428 |
| 4 | Ga0466718_018885 | 3300042617 | Unclassified | 4231 |
| 5 | Ga0466718_046033 | 3300042617 | Bacteria | 2880 |
| 6 | AustNasuHG_c1029611 | 3300000089 | Unclassified | 1598 |
| 7 | AustNasuHG_c1030764 | 3300000089 | Unclassified | 1535 |
| 8 | JGI24698J34947_10000176 | 3300002449 | Bacteria | 25045 |
| 9 | JGI24698J34947_10021888 | 3300002449 | Bacteria | 3434 |
| 10 | JGI24705J35276_11913820 | 3300002504 | Bacteria | 762 |
| 11 | JGI24700J35501_10930849 | 3300002508 | Bacteria | 27960 |
| 12 | Ga0123357_10497106 | 3300009784 | Bacteria | 1016 |
| 13 | Ga0123356_12115859 | 3300010049 | Bacteria | 703 |
| 14 | Ga0123353_10083361 | 3300010167 | Bacteria | 5144 |
| 15 | Ga0123354_10738160 | 3300010882 | Bacteria | 678 |
| 16 | Ga0466731_134775 | 3300042622 | Bacteria | 1972 |
| 17 | Ga0466719_293812 | 3300042606 | Bacteria | 4565 |
| 18 | Ga0466720_015046 | 3300042607 | Bacteria | 5721 |
| 19 | Ga0466720_025462 | 3300042607 | Bacteria | 2010 |
| 20 | Ga0466720_074950 | 3300042607 | Bacteria | 1388 |
| 21 | Ga0466694_101098 | 3300042594 | Unclassified | 4155 |
| 22 | Ga0466694_246425 | 3300042594 | Bacteria | 1390 |
| 23 | Ga0466699_062873 | 3300042597 | Unclassified | 2331 |
| 24 | Ga0466699_326999 | 3300042597 | Unclassified | 6921 |
| 25 | Ga0466712_129135 | 3300042614 | Bacteria | 16333 |
| 26 | Ga0466726_095834 | 3300042619 | Bacteria | 11792 |
| 27 | AustNasuHG_c1051383 | 3300000089 | Bacteria | 877 |
| 28 | JGI24698J34947_10204547 | 3300002449 | Unclassified | 770 |
| 29 | Ga0466708_054961 | 3300042652 | Bacteria | 8256 |
| 30 | Ga0466716_018343 | 3300042605 | Bacteria | 3764 |
| 31 | Ga0466720_131265 | 3300042607 | Bacteria | 3958 |
| 32 | Ga0466720_221041 | 3300042607 | Bacteria | 11942 |
| 33 | Ga0466722_041936 | 3300042609 | Bacteria | 19513 |
| 34 | Ga0466722_258524 | 3300042609 | Bacteria | 1512 |
| 35 | Ga0466690_279774 | 3300042590 | Bacteria | 2094 |
| 36 | Ga0466691_023580 | 3300042593 | Bacteria | 10676 |
| 37 | Ga0466694_029619 | 3300042594 | Bacteria | 1224 |
| 38 | Ga0466699_116416 | 3300042597 | Unclassified | 1201 |
| 39 | Ga0466699_270073 | 3300042597 | Bacteria | 19595 |
| 40 | Ga0466732_272065 | 3300042656 | Unclassified | 1580 |
| 41 | Ga0466712_099325 | 3300042614 | Bacteria | 2436 |
| 42 | Ga0466718_015393 | 3300042617 | Bacteria | 2653 |
| 43 | AustNasuHG_c1002811 | 3300000089 | Unclassified | 6289 |
| 44 | JGI24698J34947_10002947 | 3300002449 | Unclassified | 9234 |
| 45 | JGI24702J35022_10007956 | 3300002462 | Bacteria | 6035 |
| 46 | Ga0072941_1016687 | 3300005201 | Bacteria | 14751 |
| 47 | Ga0466704_031632 | 3300042643 | Bacteria | 13351 |
| 48 | Ga0466704_063334 | 3300042643 | Bacteria | 20231 |
| 49 | Ga0466720_103128 | 3300042607 | Bacteria | 1738 |
| 50 | Ga0466722_033995 | 3300042609 | Bacteria | 3509 |
| 51 | Ga0466698_073988 | 3300042610 | Unclassified | 1206 |
| 52 | Ga0264413_111865 | 3300024493 | Unclassified | 3372 |
| 53 | Ga0466694_399547 | 3300042594 | Bacteria | 1972 |
| 54 | Ga0466732_258973 | 3300042656 | Bacteria | 3476 |
| 55 | Ga0466712_076472 | 3300042614 | Bacteria | 5099 |
| 56 | Ga0466712_126948 | 3300042614 | Bacteria | 15581 |
| 57 | Ga0466712_178951 | 3300042614 | Unclassified | 4607 |
| 58 | Ga0466718_002893 | 3300042617 | Bacteria | 2268 |
| 59 | Ga0466718_120599 | 3300042617 | Unclassified | 1726 |
| 60 | JGI24698J34947_10085593 | 3300002449 | Bacteria | 1464 |
| 61 | JGI24698J34947_10118281 | 3300002449 | Unclassified | 1155 |
| 62 | JGI24702J35022_10013658 | 3300002462 | Bacteria | 4493 |
| 63 | Ga0074263_112672 | 3300005485 | Unclassified | 1405 |
| 64 | Ga0466720_002960 | 3300042607 | Unclassified | 2162 |
| 65 | Ga0466720_018972 | 3300042607 | Bacteria | 3880 |
| 66 | Ga0466698_105025 | 3300042610 | Bacteria | 1539 |
| 67 | Ga0466690_085688 | 3300042590 | Bacteria | 1069 |
| 68 | Ga0466690_240844 | 3300042590 | Bacteria | 1127 |
| 69 | Ga0466695_070566 | 3300042595 | Bacteria | 1828 |
| 70 | Ga0466699_355204 | 3300042597 | Bacteria | 3874 |
| 71 | Ga0466733_050858 | 3300042659 | Bacteria | 3576 |
| 72 | Ga0466733_053281 | 3300042659 | Unclassified | 2783 |
| 73 | Ga0466726_259313 | 3300042619 | Bacteria | 10801 |
| 74 | JGI24698J34947_10012041 | 3300002449 | Bacteria | 4749 |
| 75 | JGI24698J34947_10050204 | 3300002449 | Unclassified | 2105 |
| 76 | JGI24698J34947_10060898 | 3300002449 | Unclassified | 1860 |
| 77 | JGI24698J34947_10075087 | 3300002449 | Unclassified | 1608 |
| 78 | JGI24698J34947_10091442 | 3300002449 | Bacteria | 1395 |
| 79 | Ga0466727_099472 | 3300042655 | Bacteria | 1041 |
| 80 | Ga0466720_067581 | 3300042607 | Unclassified | 1652 |
| 81 | Ga0466720_217205 | 3300042607 | Bacteria | 23129 |
| 82 | Ga0466694_154764 | 3300042594 | Bacteria | 1240 |
| 83 | Ga0466699_002532 | 3300042597 | Bacteria | 37404 |
| 84 | Ga0466699_356704 | 3300042597 | Bacteria | 1060 |
| 85 | Ga0466699_418977 | 3300042597 | Bacteria | 1264 |
| 86 | Ga0466732_065076 | 3300042656 | Bacteria | 5122 |
| 87 | Ga0466733_005016 | 3300042659 | Bacteria | 22991 |
| 88 | Ga0466705_412340 | 3300042612 | Bacteria | 2421 |
| 89 | Ga0466712_159791 | 3300042614 | Unclassified | 3351 |
| 90 | Ga0466718_049045 | 3300042617 | Bacteria | 1442 |
| 91 | Ga0466718_143827 | 3300042617 | Bacteria | 4115 |
| 92 | Ga0466728_010832 | 3300042620 | Bacteria | 3482 |
| 93 | JGI24698J34947_10028497 | 3300002449 | Bacteria | 2956 |
| 94 | JGI24702J35022_10039445 | 3300002462 | Bacteria | 2519 |
| 95 | Ga0466708_136394 | 3300042652 | Bacteria | 15468 |
| 96 | Ga0466708_200610 | 3300042652 | Unclassified | 1714 |
| 97 | Ga0466716_106184 | 3300042605 | Bacteria | 2810 |
| 98 | Ga0264413_111972 | 3300024493 | Bacteria | 5210 |
| 99 | Ga0466695_389603 | 3300042595 | Bacteria | 3436 |
| 100 | Ga0466699_326842 | 3300042597 | Unclassified | 1230 |
| 101 | Ga0466699_443996 | 3300042597 | Bacteria | 1395 |
| 102 | Ga0466732_409371 | 3300042656 | Bacteria | 2075 |
| 103 | Ga0466712_016065 | 3300042614 | Unclassified | 4571 |
| 104 | Ga0466712_074417 | 3300042614 | Bacteria | 8320 |
| 105 | Ga0466718_064902 | 3300042617 | Unclassified | 1018 |
| 106 | 2230954204 | 2228664003 | Bacteria | 16844 |
| 107 | AustNasuHG_c1001617 | 3300000089 | Bacteria | 8121 |
| 108 | AustNasuHG_c1024407 | 3300000089 | Unclassified | 1915 |
| 109 | AustNasuHG_c1056938 | 3300000089 | Unclassified | 784 |
| 110 | Ga0072940_1025755 | 3300005200 | Bacteria | 3731 |
| 111 | Ga0123357_10179145 | 3300009784 | Bacteria | 2481 |
| 112 | Ga0123357_10931246 | 3300009784 | Bacteria | 555 |
| 113 | Ga0466708_157464 | 3300042652 | Bacteria | 10850 |
| 114 | Ga0466708_158260 | 3300042652 | Bacteria | 21135 |
| 115 | Ga0466720_063009 | 3300042607 | Bacteria | 1575 |
| 116 | Ga0466720_078678 | 3300042607 | Bacteria | 3195 |
| 117 | Ga0466720_101148 | 3300042607 | Bacteria | 2492 |
| 118 | Ga0466721_083090 | 3300042608 | Bacteria | 3319 |
| 119 | Ga0466698_075719 | 3300042610 | Bacteria | 1592 |
| 120 | Ga0466690_292871 | 3300042590 | Bacteria | 1097 |
| 121 | Ga0466694_253114 | 3300042594 | Unclassified | 1457 |
| 122 | Ga0466694_301696 | 3300042594 | Bacteria | 3890 |
| 123 | Ga0466699_037584 | 3300042597 | Unclassified | 2628 |
| 124 | Ga0466732_085505 | 3300042656 | Bacteria | 1527 |
| 125 | Ga0466733_188383 | 3300042659 | Bacteria | 2224 |
| 126 | Ga0466712_162904 | 3300042614 | Bacteria | 1693 |
| 127 | Ga0466718_011537 | 3300042617 | Bacteria | 9686 |
| 128 | Ga0466718_150269 | 3300042617 | Bacteria | 1849 |
| 129 | Ga0466718_155134 | 3300042617 | Unclassified | 3271 |
| 130 | Ga0466718_167109 | 3300042617 | Bacteria | 1222 |
| 131 | JGI24698J34947_10005469 | 3300002449 | Bacteria | 6973 |
| 132 | JGI24698J34947_10012430 | 3300002449 | Bacteria | 4665 |
| 133 | JGI24698J34947_10014584 | 3300002449 | Bacteria | 4280 |
| 134 | JGI24698J34947_10127341 | 3300002449 | Bacteria | 1094 |
| 135 | JGI24698J34947_10166651 | 3300002449 | Unclassified | 896 |
| 136 | JGI24702J35022_10430442 | 3300002462 | Bacteria | 801 |
| 137 | Ga0123354_10021538 | 3300010882 | Bacteria | 10158 |
| 138 | Ga0466717_123792 | 3300042604 | Bacteria | 1231 |
| 139 | Ga0466693_023785 | 3300042592 | Bacteria | 4499 |
| 140 | Ga0466699_329678 | 3300042597 | Bacteria | 2644 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF15919 | HicB_lk_antitox | HicB_like antitoxin of bacterial toxin-antitoxin system | 5 | 83 | 0.86 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.