Protein Family IF03551

Metagenome Isolate
141 Members
44 Samples
126 Scaffolds
291.52 Avg Length

🧬 Representative Sequence

ID
3300010882|Ga0123354_10371518|Ga0123354_103715182
Length
316 aa
Sequence
MQKKVAGDWFYMDLEWFLLSLPILLEQCWHTLVNLFPYLAAGVLIGELLKFTSWTKIIYKWTSKSPFVAVLAASVIGAVSPLCTYGTIPVVIELYKSGVHIAPLVTFLAASSLINPQLFVMTAGGIDGIGLEMALVLTASIILVSLALGLLTYLVPQKYIVKKNIALYDDGGCNIINREKKLFIVRQYFINCAKNLKNVGFYVLIGIMLGAAIELYIPKVWIHNALGTQQGVRSILFASLLGVPLYACGGGAIPLVNKMMQNGMGKGSGLAFFIVGSATRPAPIAAMAILFTPLFLVAYCVFLIAASVLVGLIYV*

📊 Sample Types

Isolate 9.9%
Metagenome 90.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 47.6%
Unclassified 31.0%
Kalotermitidae 19.0%
Rhinotermitidae 2.4%

🌳 Taxonomy

Archaea 1
Bacteria 113
Eukaryota 0
Viruses 0
Unclassified 27

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125660 Treponema sp. Emb289P3bin52 Isolate Unclassified
2 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
3 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
4 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
5 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
6 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
7 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
8 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
9 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
10 2820252425 Unclassified Firmicutes Th196P3bin6 Isolate Unclassified
11 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
12 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
13 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
14 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
15 2781125635 Treponema sp. Co191P1bin60 Isolate Unclassified
16 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
17 2781125638 Treponema sp. Co191P1bin8 Isolate Unclassified
18 2781125649 Treponema sp. Co191P3bin15 Isolate Unclassified
19 2820551407 Unclassified Firmicutes Emb289P4bin38 Isolate Unclassified
20 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
21 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
22 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
23 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
24 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
25 2781125648 Treponema sp. Co191P3bin70 Isolate Unclassified
26 2820385248 Unclassified Firmicutes Nt197P1bin19 Isolate Unclassified
27 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
28 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
29 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
30 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
31 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
32 2781125637 Treponema sp. Co191P1bin9 Isolate Unclassified
33 2781125641 Treponema sp. Co191P1bin27 Isolate Unclassified
34 2781125642 Treponema sp. Co191P1bin35 Isolate Unclassified
35 2820630457 Unclassified Firmicutes Emb289P1bin119 Isolate Unclassified
36 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
37 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
38 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
39 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
40 2781125645 Treponema sp. Co191P3bin32 Isolate Unclassified
41 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
42 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
43 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
44 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466712_123724 3300042614 Unclassified 1105
2 Ga0123356_10000020 3300010049 Bacteria 177064
3 Ga0123354_10371518 3300010882 Unclassified 1247
4 Ga0466700_429210 3300042600 Bacteria 6333
5 Ga0466720_019046 3300042607 Bacteria 3647
6 Ga0466720_030653 3300042607 Unclassified 5715
7 Ga0466720_031861 3300042607 Bacteria 4605
8 Ga0466720_044353 3300042607 Bacteria 6821
9 Ga0264413_109461 3300024493 Bacteria 5263
10 Ga0466693_139526 3300042592 Bacteria 2944
11 Ga0466694_181503 3300042594 Bacteria 1932
12 JGI24695J34938_10002778 3300002450 Bacteria 12836
13 JGI24695J34938_10004415 3300002450 Bacteria 9248
14 JGI24695J34938_10039060 3300002450 Bacteria 2147
15 Ga0072940_1149409 3300005200 Bacteria 1337
16 Ga0072941_1007707 3300005201 Bacteria 7271
17 Ga0072941_1009359 3300005201 Bacteria 34397
18 Ga0072941_1060101 3300005201 Bacteria 21928
19 Ga0466732_018335 3300042656 Unclassified 11394
20 Ga0123355_10004414 3300009826 Bacteria 20451
21 Ga0466719_102690 3300042606 Unclassified 1080
22 Ga0466720_028663 3300042607 Bacteria 1716
23 Ga0466720_034188 3300042607 Unclassified 1481
24 Ga0264413_108170 3300024493 Bacteria 6577
25 Ga0466694_062813 3300042594 Bacteria 10643
26 Ga0466694_149800 3300042594 Bacteria 13862
27 Ga0466699_037483 3300042597 Bacteria 31779
28 AustNasuHG_c1001350 3300000089 Bacteria 8801
29 JGI24698J34947_10000123 3300002449 Bacteria 27757
30 JGI24698J34947_10050809 3300002449 Unclassified 2089
31 JGI24695J34938_10004556 3300002450 Bacteria 9033
32 JGI24695J34938_10004812 3300002450 Bacteria 8681
33 JGI24695J34938_10009495 3300002450 Bacteria 5407
34 JGI24695J34938_10020613 3300002450 Bacteria 3241
35 JGI24695J34938_10021800 3300002450 Bacteria 3124
36 Ga0072941_1012319 3300005201 Bacteria 9578
37 Ga0072941_1083252 3300005201 Bacteria 2240
38 Ga0466703_025422 3300042636 Bacteria 5999
39 Ga0466732_107716 3300042656 Bacteria 13918
40 Ga0466712_041651 3300042614 Bacteria 4213
41 Ga0466712_052372 3300042614 Bacteria 14538
42 Ga0466712_145279 3300042614 Unclassified 5550
43 Ga0466718_035890 3300042617 Bacteria 4250
44 Ga0466718_088546 3300042617 Bacteria 23804
45 Ga0466718_158621 3300042617 Bacteria 3612
46 Ga0123356_10023038 3300010049 Archaea 5869
47 Ga0123353_10580941 3300010167 Bacteria 1607
48 Ga0466716_172875 3300042605 Bacteria 1939
49 Ga0466720_051267 3300042607 Unclassified 2851
50 Ga0264413_101930 3300024493 Bacteria 5669
51 Ga0264413_101931 3300024493 Bacteria 6451
52 AustNasuHG_c1006877 3300000089 Unclassified 4053
53 JGI24703J35330_11718754 3300002501 Unclassified 2336
54 Ga0466732_164085 3300042656 Bacteria 10652
55 Ga0466732_284529 3300042656 Bacteria 2543
56 Ga0466712_218573 3300042614 Bacteria 3843
57 Ga0466715_047991 3300042616 Unclassified 1519
58 Ga0123356_10052656 3300010049 Bacteria 3787
59 Ga0123356_10292441 3300010049 Bacteria 1730
60 Ga0466720_012424 3300042607 Bacteria 15798
61 Ga0466720_018543 3300042607 Bacteria 131979
62 Ga0466720_033556 3300042607 Bacteria 1710
63 Ga0466690_262510 3300042590 Unclassified 2374
64 JGI24698J34947_10014977 3300002449 Bacteria 4222
65 JGI24695J34938_10000298 3300002450 Bacteria 48953
66 Ga0072940_1070929 3300005200 Bacteria 3771
67 Ga0072941_1039600 3300005201 Bacteria 4520
68 Ga0466702_039967 3300042635 Bacteria 3427
69 Ga0466702_130580 3300042635 Bacteria 15427
70 Ga0466718_084091 3300042617 Bacteria 21188
71 Ga0466718_085318 3300042617 Bacteria 2161
72 Ga0123354_10181142 3300010882 Bacteria 2404
73 Ga0466717_244546 3300042604 Bacteria 1452
74 Ga0466720_042687 3300042607 Bacteria 19824
75 Ga0466720_122628 3300042607 Bacteria 1551
76 Ga0466720_137070 3300042607 Bacteria 34404
77 Ga0466722_187475 3300042609 Bacteria 6340
78 Ga0466694_296389 3300042594 Bacteria 1728
79 AustNasuHG_c1020517 3300000089 Bacteria 2151
80 JGI24695J34938_10005720 3300002450 Unclassified 7673
81 JGI24695J34938_10020481 3300002450 Bacteria 3254
82 JGI24695J34938_10020529 3300002450 Bacteria 3249
83 Ga0072940_1040648 3300005200 Bacteria 9870
84 Ga0466705_478763 3300042612 Unclassified 5753
85 Ga0466712_233583 3300042614 Bacteria 3166
86 Ga0123353_10284043 3300010167 Bacteria 2539
87 Ga0466720_092128 3300042607 Unclassified 5696
88 Ga0466720_098457 3300042607 Bacteria 5396
89 Ga0264413_105312 3300024493 Bacteria 7260
90 Ga0415639_055717 3300038395 Unclassified 2059
91 Ga0466693_385659 3300042592 Bacteria 1021
92 Ga0466696_088957 3300042596 Bacteria 4931
93 AustNasuHG_c1001652 3300000089 Bacteria 8039
94 JGI24698J34947_10004478 3300002449 Bacteria 7608
95 JGI24695J34938_10000161 3300002450 Bacteria 62308
96 JGI24695J34938_10010532 3300002450 Bacteria 5050
97 JGI24695J34938_10014685 3300002450 Bacteria 4048
98 Ga0072941_1249685 3300005201 Unclassified 1453
99 Ga0466718_000845 3300042617 Unclassified 1253
100 Ga0466718_106068 3300042617 Unclassified 5973
101 Ga0466728_255818 3300042620 Unclassified 1073
102 Ga0123356_10547858 3300010049 Bacteria 1317
103 Ga0466720_120641 3300042607 Unclassified 2180
104 Ga0466720_179904 3300042607 Bacteria 20155
105 Ga0466720_222685 3300042607 Unclassified 10361
106 Ga0264413_102755 3300024493 Bacteria 22484
107 Ga0415639_034302 3300038395 Bacteria 7554
108 Ga0466693_248130 3300042592 Bacteria 3646
109 Ga0466693_263216 3300042592 Bacteria 22289
110 JGI24698J34947_10051841 3300002449 Bacteria 2061
111 JGI24698J34947_10077982 3300002449 Bacteria 1564
112 JGI24695J34938_10001135 3300002450 Bacteria 23850
113 Ga0072941_1002960 3300005201 Bacteria 30532
114 Ga0072941_1112805 3300005201 Unclassified 1902
115 Ga0466705_032008 3300042612 Unclassified 9321
116 Ga0466718_107916 3300042617 Unclassified 2821
117 Ga0466720_004151 3300042607 Bacteria 10308
118 Ga0466720_094351 3300042607 Bacteria 6391
119 JGI24698J34947_10019343 3300002449 Bacteria 3673
120 JGI24698J34947_10034549 3300002449 Unclassified 2645
121 JGI24695J34938_10001792 3300002450 Bacteria 17661
122 JGI24695J34938_10002296 3300002450 Bacteria 14738
123 JGI24695J34938_10002607 3300002450 Bacteria 13565
124 JGI24703J35330_11747769 3300002501 Bacteria 8161
125 Ga0072941_1010185 3300005201 Bacteria 38031
126 Ga0072941_1012758 3300005201 Bacteria 3810

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF03773 ArsP_1 Predicted permease 32 314 0.86

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.