Protein Family IF03507

Metagenome Isolate
125 Members
44 Samples
116 Scaffolds
222.55 Avg Length

🧬 Representative Sequence

ID
3300010882|Ga0123354_10103294|Ga0123354_101032943
Length
248 aa
Sequence
MIEYIVPGNIDDRILARAANLLQGGGTIGIPTDTSWSIVCSMNSREGLKKLKALSKDREERHFTLLCSDISQFGEFCSLDNSRFRLIKRLTPGPYVFILKTLLGTEKTLGLKRREIGIRLPDYPVPLALIKTLGNPLYGITAKRNMTMNTADQDTEYDVSDPYNRDYERRSRNKDNDELPEENGSAGDSLFFREETLFDGGWEMEDIQGLDLILDPGEDRNRIFSTVLDISNGDVQILRVGAGLWPI*

📊 Sample Types

Isolate 7.2%
Metagenome 92.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 57.1%
Unclassified 21.4%
Kalotermitidae 14.3%
Termopsidae 4.8%
Rhinotermitidae 2.4%

🌳 Taxonomy

Archaea 0
Bacteria 121
Eukaryota 0
Viruses 0
Unclassified 4

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125686 Treponema sp. Lab288P4bin22 Isolate Unclassified
2 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
3 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
4 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
5 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
6 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
7 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
8 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
9 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
10 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
11 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
12 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
13 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
14 2781125632 Treponema sp. Co191P1bin87 Isolate Unclassified
15 2781125655 Treponema sp. Emb289P1bin105 Isolate Unclassified
16 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
17 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
18 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
19 2781125639 Treponema sp. Co191P1bin44 Isolate Unclassified
20 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
21 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
22 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
23 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
24 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
25 2781125694 Treponema sp. Th196P3bin120 Isolate Unclassified
26 2781125697 Treponema sp. Th196P4bin17 Isolate Unclassified
27 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
28 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
29 2781125653 Treponema sp. Emb289P1bin107 Isolate Unclassified
30 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
31 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
32 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
33 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
34 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
35 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
36 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
37 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
38 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
39 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
40 2781125681 Treponema sp. Lab288P1bin11 Isolate Unclassified
41 2781125690 Treponema sp. Th196P3bin63 Isolate Unclassified
42 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
43 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
44 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466712_096443 3300042614 Unclassified 6056
2 Ga0466715_105942 3300042616 Bacteria 1021
3 Ga0466694_150044 3300042594 Bacteria 1544
4 Ga0466699_140707 3300042597 Bacteria 1410
5 Ga0123357_10048315 3300009784 Bacteria 5767
6 Ga0466700_111933 3300042600 Bacteria 1797
7 Ga0466700_302132 3300042600 Bacteria 1353
8 Ga0466700_319615 3300042600 Bacteria 1480
9 JGI24698J34947_10030018 3300002449 Bacteria 2869
10 JGI24698J34947_10112713 3300002449 Bacteria 1197
11 JGI24702J35022_10015696 3300002462 Bacteria 4161
12 Ga0466733_064448 3300042659 Bacteria 6641
13 Ga0466715_135877 3300042616 Bacteria 2812
14 Ga0264413_105354 3300024493 Bacteria 6864
15 Ga0466693_026824 3300042592 Bacteria 17509
16 Ga0123357_10018224 3300009784 Bacteria 9326
17 Ga0123355_10067052 3300009826 Bacteria 5777
18 Ga0123353_10012240 3300010167 Bacteria 12176
19 Ga0123353_10351003 3300010167 Bacteria 2223
20 Ga0123353_10682303 3300010167 Bacteria 1446
21 Ga0123354_10197835 3300010882 Bacteria 2222
22 Ga0123354_10490495 3300010882 Bacteria 965
23 Ga0466700_065047 3300042600 Bacteria 2268
24 Ga0466698_009326 3300042610 Bacteria 1445
25 JGI24698J34947_10000257 3300002449 Bacteria 22530
26 JGI24698J34947_10004026 3300002449 Bacteria 7989
27 Ga0072941_1116209 3300005201 Bacteria 5518
28 Ga0466712_079422 3300042614 Bacteria 10652
29 Ga0466712_190593 3300042614 Unclassified 1650
30 Ga0466715_030732 3300042616 Bacteria 5287
31 Ga0466718_044510 3300042617 Bacteria 1142
32 Ga0466718_132601 3300042617 Bacteria 3502
33 Ga0466718_155641 3300042617 Bacteria 1097
34 Ga0466726_077426 3300042619 Bacteria 2440
35 Ga0466694_393664 3300042594 Bacteria 6263
36 Ga0123357_10056232 3300009784 Bacteria 5292
37 Ga0123357_10192356 3300009784 Bacteria 2347
38 Ga0123353_10054990 3300010167 Bacteria 6366
39 Ga0123353_10901969 3300010167 Bacteria 1203
40 Ga0123354_10084215 3300010882 Unclassified 4467
41 JGI24698J34947_10002917 3300002449 Bacteria 9271
42 JGI24698J34947_10007396 3300002449 Bacteria 6039
43 JGI24702J35022_10155064 3300002462 Bacteria 1287
44 Ga0466733_056132 3300042659 Bacteria 1557
45 Ga0466712_083338 3300042614 Bacteria 6311
46 Ga0466715_017954 3300042616 Bacteria 6763
47 Ga0466715_325845 3300042616 Bacteria 20888
48 Ga0264413_124287 3300024493 Bacteria 4040
49 Ga0466693_085790 3300042592 Bacteria 1367
50 Ga0466694_119440 3300042594 Bacteria 7322
51 Ga0466699_225979 3300042597 Bacteria 5854
52 Ga0466699_270851 3300042597 Bacteria 2961
53 Ga0466699_370929 3300042597 Bacteria 1552
54 Ga0123357_10166277 3300009784 Bacteria 2626
55 Ga0123357_10356548 3300009784 Bacteria 1391
56 Ga0123353_10075715 3300010167 Bacteria 5408
57 Ga0123353_10954024 3300010167 Bacteria 1160
58 JGI24698J34947_10075491 3300002449 Bacteria 1602
59 JGI24702J35022_10020198 3300002462 Bacteria 3618
60 Ga0466709_182489 3300042648 Bacteria 2254
61 Ga0466708_009540 3300042652 Bacteria 24875
62 Ga0466697_156288 3300042611 Bacteria 1479
63 Ga0466712_230432 3300042614 Unclassified 1790
64 Ga0466723_152354 3300042618 Bacteria 1626
65 Ga0466694_319277 3300042594 Bacteria 2230
66 Ga0466699_334509 3300042597 Bacteria 2184
67 Ga0123353_10262969 3300010167 Bacteria 2663
68 Ga0123353_10342802 3300010167 Bacteria 2256
69 Ga0123353_10371311 3300010167 Bacteria 2144
70 Ga0466700_311910 3300042600 Bacteria 1092
71 JGI24698J34947_10009084 3300002449 Bacteria 5454
72 JGI24698J34947_10023450 3300002449 Bacteria 3303
73 JGI24702J35022_10014498 3300002462 Bacteria 4349
74 JGI24705J35276_12227161 3300002504 Bacteria 2956
75 Ga0466727_108320 3300042655 Bacteria 1997
76 Ga0466733_183150 3300042659 Bacteria 2447
77 Ga0466712_080527 3300042614 Bacteria 30079
78 Ga0466712_211240 3300042614 Bacteria 4196
79 Ga0123353_10009783 3300010167 Bacteria 13282
80 Ga0123353_10547994 3300010167 Bacteria 1669
81 Ga0123353_10928619 3300010167 Bacteria 1180
82 Ga0123354_10103294 3300010882 Bacteria 3834
83 Ga0466720_081404 3300042607 Bacteria 8059
84 Ga0466722_153335 3300042609 Bacteria 4254
85 JGI24695J34938_10018417 3300002450 Bacteria 3492
86 JGI24702J35022_10117748 3300002462 Bacteria 1465
87 JGI24696J40584_12956547 3300002834 Bacteria 3148
88 Ga0466731_059835 3300042622 Bacteria 1623
89 Ga0466703_243646 3300042636 Bacteria 3712
90 Ga0466712_084184 3300042614 Bacteria 5293
91 Ga0466712_170847 3300042614 Bacteria 9996
92 Ga0466712_323316 3300042614 Bacteria 1660
93 Ga0466693_347797 3300042592 Bacteria 1231
94 Ga0466694_015512 3300042594 Bacteria 1064
95 Ga0123355_10002747 3300009826 Bacteria 24950
96 Ga0123355_10008022 3300009826 Bacteria 15919
97 Ga0123356_11064354 3300010049 Bacteria 978
98 Ga0123353_10279123 3300010167 Bacteria 2567
99 Ga0123353_10474408 3300010167 Bacteria 1833
100 Ga0466698_455967 3300042610 Bacteria 1699
101 AustNasuHG_c1000426 3300000089 Bacteria 14673
102 JGI24698J34947_10009665 3300002449 Bacteria 5285
103 Ga0466718_070284 3300042617 Bacteria 2825
104 Ga0466694_070661 3300042594 Bacteria 23704
105 Ga0466695_233126 3300042595 Bacteria 8309
106 Ga0123357_10075709 3300009784 Bacteria 4447
107 Ga0123356_10842850 3300010049 Bacteria 1088
108 Ga0123353_10042054 3300010167 Bacteria 7225
109 Ga0123353_11118524 3300010167 Bacteria 1044
110 Ga0466719_006631 3300042606 Bacteria 11517
111 Ga0466720_111147 3300042607 Bacteria 1022
112 Ga0466698_507044 3300042610 Bacteria 2044
113 JGI24702J35022_10004064 3300002462 Bacteria 8756
114 JGI24702J35022_10004367 3300002462 Bacteria 8420
115 JGI24702J35022_10014357 3300002462 Bacteria 4369
116 Ga0466702_460418 3300042635 Bacteria 1248

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300005201 Ga0072941_1116209 Ga0072941_11162098 181
2 3300042597 Ga0466699_140707 Ga0466699_140707_781_1365 194
3 3300042609 Ga0466722_153335 Ga0466722_153335_1929_2624 199
4 3300042655 Ga0466727_108320 Ga0466727_108320_264_908 200
5 3300042597 Ga0466699_334509 Ga0466699_334509_1448_2173 204
6 3300042606 Ga0466719_006631 Ga0466719_006631_4967_5590 207
7 3300042616 Ga0466715_030732 Ga0466715_030732_1994_2617 207
8 3300042616 Ga0466715_325845 Ga0466715_325845_8733_9356 207
9 3300042618 Ga0466723_152354 Ga0466723_152354_732_1355 207
10 3300042636 Ga0466703_243646 Ga0466703_243646_1886_2512 208
11 3300042622 Ga0466731_059835 Ga0466731_059835_373_1080 209
12 3300024493 Ga0264413_105354 Ga0264413_1053542 212
13 3300042595 Ga0466695_233126 Ga0466695_233126_7321_7959 212
14 3300042597 Ga0466699_225979 Ga0466699_225979_4769_5467 212
15 3300042607 Ga0466720_081404 Ga0466720_081404_1357_1995 212
16 3300042607 Ga0466720_111147 Ga0466720_111147_344_982 212
17 3300042617 Ga0466718_044510 Ga0466718_044510_389_1027 212
18 3300042617 Ga0466718_070284 Ga0466718_070284_124_762 212
19 3300042617 Ga0466718_132601 Ga0466718_132601_2117_2755 212
20 3300042617 Ga0466718_155641 Ga0466718_155641_289_927 212
21 3300000089 AustNasuHG_c1000426 AustNasuHG_100042615 213
22 3300024493 Ga0264413_124287 Ga0264413_1242873 213
23 3300010167 Ga0123353_10371311 Ga0123353_103713112 214
24 3300042610 Ga0466698_507044 Ga0466698_507044_570_1229 214
25 3300002462 JGI24702J35022_10004367 JGI24702J35022_100043675 215
26 3300009784 Ga0123357_10048315 Ga0123357_100483155 215
27 3300010167 Ga0123353_10075715 Ga0123353_100757153 215
28 3300010167 Ga0123353_11118524 Ga0123353_111185242 215
29 3300042600 Ga0466700_065047 Ga0466700_065047_1528_2175 215
30 3300042616 Ga0466715_105942 Ga0466715_105942_127_774 215
31 3300042616 Ga0466715_135877 Ga0466715_135877_470_1117 215
32 3300042648 Ga0466709_182489 Ga0466709_182489_74_721 215
33 3300042619 Ga0466726_077426 Ga0466726_077426_11_661 216
34 3300042610 Ga0466698_009326 Ga0466698_009326_525_1178 217
35 3300002462 JGI24702J35022_10020198 JGI24702J35022_100201983 218
36 3300010167 Ga0123353_10351003 Ga0123353_103510033 218
37 iso_pr_bacteria 2781125694 2781435935 218
38 3300042600 Ga0466700_302132 Ga0466700_302132_385_1044 219
39 3300010167 Ga0123353_10012240 Ga0123353_100122406 220
40 3300010167 Ga0123353_10042054 Ga0123353_100420542 220
41 3300042597 Ga0466699_370929 Ga0466699_370929_689_1351 220
42 3300042600 Ga0466700_111933 Ga0466700_111933_270_932 220
43 3300042610 Ga0466698_455967 Ga0466698_455967_891_1553 220
44 3300042614 Ga0466712_170847 Ga0466712_170847_2271_2933 220
45 3300042614 Ga0466712_323316 Ga0466712_323316_913_1575 220
46 3300042635 Ga0466702_460418 Ga0466702_460418_250_912 220
47 3300002462 JGI24702J35022_10014357 JGI24702J35022_100143575 221
48 3300002462 JGI24702J35022_10155064 JGI24702J35022_101550642 221
49 3300010167 Ga0123353_10682303 Ga0123353_106823032 221
50 3300042594 Ga0466694_150044 Ga0466694_150044_544_1263 221
51 3300042594 Ga0466694_319277 Ga0466694_319277_549_1214 221
52 3300042616 Ga0466715_017954 Ga0466715_017954_162_827 221
53 3300042652 Ga0466708_009540 Ga0466708_009540_18311_18976 221
54 3300009826 Ga0123355_10008022 Ga0123355_1000802214 222
55 3300010167 Ga0123353_10279123 Ga0123353_102791232 222
56 3300010882 Ga0123354_10490495 Ga0123354_104904951 222
57 3300042592 Ga0466693_085790 Ga0466693_085790_145_813 222
58 3300042594 Ga0466694_015512 Ga0466694_015512_358_1026 222
59 3300042659 Ga0466733_056132 Ga0466733_056132_761_1429 222
60 3300042659 Ga0466733_064448 Ga0466733_064448_3571_4239 222
61 iso_pr_bacteria 2781125690 2781428157 222
62 3300010049 Ga0123356_11064354 Ga0123356_110643541 223
63 3300002834 JGI24696J40584_12956547 JGI24696J40584_129565472 224
64 3300009826 Ga0123355_10067052 Ga0123355_100670523 224
65 3300002462 JGI24702J35022_10014498 JGI24702J35022_100144982 225
66 3300010167 Ga0123353_10009783 Ga0123353_100097834 225
67 3300010167 Ga0123353_10054990 Ga0123353_100549904 225
68 3300042594 Ga0466694_119440 Ga0466694_119440_6326_7003 225
69 3300042600 Ga0466700_311910 Ga0466700_311910_246_923 225
70 3300042600 Ga0466700_319615 Ga0466700_319615_173_850 225
71 3300042614 Ga0466712_079422 Ga0466712_079422_3828_4505 225
72 3300042614 Ga0466712_080527 Ga0466712_080527_15431_16108 225
73 3300042614 Ga0466712_083338 Ga0466712_083338_5401_6078 225
74 3300042614 Ga0466712_084184 Ga0466712_084184_2008_2685 225
75 3300042614 Ga0466712_096443 Ga0466712_096443_4025_4702 225
76 3300042614 Ga0466712_190593 Ga0466712_190593_511_1188 225
77 3300042614 Ga0466712_211240 Ga0466712_211240_1355_2032 225
78 3300042614 Ga0466712_230432 Ga0466712_230432_783_1460 225
79 3300002449 JGI24698J34947_10000257 JGI24698J34947_1000025719 226
80 3300002449 JGI24698J34947_10004026 JGI24698J34947_100040265 226
81 3300002449 JGI24698J34947_10007396 JGI24698J34947_100073964 226
82 3300002449 JGI24698J34947_10009084 JGI24698J34947_100090844 226
83 3300002449 JGI24698J34947_10009665 JGI24698J34947_100096654 226
84 3300002449 JGI24698J34947_10023450 JGI24698J34947_100234502 226
85 3300002449 JGI24698J34947_10030018 JGI24698J34947_100300182 226
86 3300002449 JGI24698J34947_10075491 JGI24698J34947_100754912 226
87 3300002449 JGI24698J34947_10112713 JGI24698J34947_101127132 226
88 3300009784 Ga0123357_10192356 Ga0123357_101923562 226
89 3300010167 Ga0123353_10928619 Ga0123353_109286192 226
90 3300010167 Ga0123353_10342802 Ga0123353_103428022 227
91 3300042592 Ga0466693_026824 Ga0466693_026824_12868_13554 228
92 3300042659 Ga0466733_183150 Ga0466733_183150_613_1299 228
93 iso_pr_bacteria 2781125639 2781285870 228
94 3300002450 JGI24695J34938_10018417 JGI24695J34938_100184171 229
95 3300002462 JGI24702J35022_10117748 JGI24702J35022_101177482 229
96 3300042611 Ga0466697_156288 Ga0466697_156288_654_1343 229
97 iso_pr_bacteria 2781125632 2781272160 229
98 iso_pr_bacteria 2781125655 2781318014 229
99 3300009784 Ga0123357_10056232 Ga0123357_100562324 230
100 3300009826 Ga0123355_10002747 Ga0123355_1000274711 230
101 3300010049 Ga0123356_10842850 Ga0123356_108428502 230
102 3300010167 Ga0123353_10901969 Ga0123353_109019692 230
103 3300042594 Ga0466694_070661 Ga0466694_070661_5348_6040 230
104 3300002449 JGI24698J34947_10002917 JGI24698J34947_100029173 231
105 3300010167 Ga0123353_10262969 Ga0123353_102629692 231
106 3300042592 Ga0466693_347797 Ga0466693_347797_356_1051 231
107 3300042597 Ga0466699_270851 Ga0466699_270851_694_1389 231
108 3300002462 JGI24702J35022_10004064 JGI24702J35022_100040646 232
109 3300009784 Ga0123357_10166277 Ga0123357_101662772 233
110 iso_pr_bacteria 2781125653 2781313104 233
111 3300010167 Ga0123353_10547994 Ga0123353_105479942 234
112 3300002504 JGI24705J35276_12227161 JGI24705J35276_122271612 236
113 3300010167 Ga0123353_10474408 Ga0123353_104744082 236
114 iso_pr_bacteria 2781125681 2781407763 237
115 iso_pr_bacteria 2781125697 2781443538 237
116 3300002462 JGI24702J35022_10015696 JGI24702J35022_100156963 238
117 3300009784 Ga0123357_10075709 Ga0123357_100757094 238
118 3300009784 Ga0123357_10356548 Ga0123357_103565482 238
119 3300042594 Ga0466694_393664 Ga0466694_393664_4085_4801 238
120 3300010167 Ga0123353_10954024 Ga0123353_109540242 239
121 3300010882 Ga0123354_10084215 Ga0123354_100842153 239
122 3300009784 Ga0123357_10018224 Ga0123357_100182243 240
123 3300010882 Ga0123354_10197835 Ga0123354_101978353 245
124 iso_pr_bacteria 2781125686 2781418934 247
125 3300010882 Ga0123354_10103294 Ga0123354_101032943 248

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01300 Sua5_yciO_yrdC Telomere recombination 21 144 0.9

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF01300 GO:0003725 double-stranded RNA binding MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.78 0.87 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.