Protein Family IF03499
Metagenome
Isolate
138
Members
57
Samples
117
Scaffolds
383.22
Avg Length
Representative Sequence
- ID
- 3300010882|Ga0123354_10082567|Ga0123354_100825673
- Length
- 455 aa
- Sequence
- MDTSKIREKFKSLYGTTGSVYTSPGRVNLIGEHTDYNGGFVLPGAIDKAMYCEIKPNGTNKVRAFALDLGESAEFGLEEADKPAQQWARYIFGVCREMAKRGKQVGGFDTVFAGDVPLGAGMSSSAALESCFGFALDDLFNLGLERFEIALIGQSTEHNYVGVMCGIMDQFASCCGKEGHLMRLDCRSLEFEYVPFNPKGYRLVLINTCVTHNLAGGEYNKRRLSCERVVAAIAKRHPEVKLLRDANMAMLAEVKGEVDAVDYMRAEFVVEEIQRLLDACAAMEKDDYETVGRLMYGTHHGLSKLYEVSCPELDFLNDMAKECGVTGSRIMGGGFGGCTINLVKNELYDSFVKKATEAYKAKFGIDAKVYDVVIKDGARKAGVKPRLSTTARTSITGFYRRCHTRYRRRPPRXSPVRLFGSCFYSCHRSRKSAFYQPESRIWRNSSHGDDSLTD*
Sample Types
Isolate
15.2%
Metagenome
84.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
25.0%
Kalotermitidae
23.2%
Unclassified
14.3%
Blattidae
14.3%
Rhinotermitidae
8.9%
Termopsidae
5.4%
Hydrophilidae
3.6%
Passalidae
3.6%
Tenebrionidae
1.8%
Taxonomy
Archaea
0
Bacteria
134
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 2 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 3 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 4 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 5 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 6 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 7 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 8 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 9 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 10 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 11 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 12 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 13 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 14 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 15 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 16 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 17 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 18 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 19 | 2820768849 | Unclassified Bacteroidetes Lab288P3bin194 | Isolate | Unclassified |
| 20 | 2820774381 | Unclassified Bacteroidetes Lab288P1bin37 | Isolate | Unclassified |
| 21 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 22 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 23 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 24 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 25 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 26 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 27 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 28 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 29 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 30 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 31 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 32 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 33 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 34 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 35 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 36 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 37 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 38 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 39 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 40 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 41 | 2910949487 | Dysgonomonas sp. 520 | Isolate | Blattidae |
| 42 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 43 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 44 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 45 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 46 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 47 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 48 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 49 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 50 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 51 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 52 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 53 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 54 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 55 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 56 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 57 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_260334 | 3300042611 | Bacteria | 2658 |
| 2 | Ga0466733_183783 | 3300042659 | Bacteria | 3194 |
| 3 | JGI24699J35502_11134018 | 3300002509 | Bacteria | 24446 |
| 4 | Ga0466707_087386 | 3300042601 | Bacteria | 25499 |
| 5 | Ga0466713_139646 | 3300042602 | Bacteria | 516516 |
| 6 | Ga0466714_073873 | 3300042603 | Bacteria | 17431 |
| 7 | Ga0123354_10085693 | 3300010882 | Unclassified | 4411 |
| 8 | Ga0123354_10196106 | 3300010882 | Bacteria | 2240 |
| 9 | Ga0466715_212551 | 3300042616 | Bacteria | 9142 |
| 10 | Ga0466735_029550 | 3300042624 | Bacteria | 5603 |
| 11 | Ga0466709_054618 | 3300042648 | Bacteria | 102226 |
| 12 | Ga0466727_096280 | 3300042655 | Bacteria | 1428 |
| 13 | 2227467976 | 2225789004 | Bacteria | 5038 |
| 14 | IMNBL1DRAFT_c0003167 | 3300000062 | Bacteria | 10790 |
| 15 | JGI24705J35276_12221232 | 3300002504 | Bacteria | 2325 |
| 16 | Ga0466691_093787 | 3300042593 | Bacteria | 5766 |
| 17 | Ga0466696_007849 | 3300042596 | Bacteria | 54852 |
| 18 | Ga0466700_016544 | 3300042600 | Bacteria | 2573 |
| 19 | Ga0466707_065776 | 3300042601 | Bacteria | 7239 |
| 20 | Ga0466713_059661 | 3300042602 | Bacteria | 2390 |
| 21 | Ga0466719_446548 | 3300042606 | Bacteria | 6852 |
| 22 | Ga0466722_222202 | 3300042609 | Bacteria | 7709 |
| 23 | Ga0123353_10000136 | 3300010167 | Bacteria | 89026 |
| 24 | Ga0466715_259821 | 3300042616 | Bacteria | 31019 |
| 25 | Ga0466723_312424 | 3300042618 | Bacteria | 3940 |
| 26 | Ga0466726_385773 | 3300042619 | Bacteria | 1786 |
| 27 | Ga0466735_100916 | 3300042624 | Bacteria | 3924 |
| 28 | Ga0466704_140628 | 3300042643 | Bacteria | 15835 |
| 29 | Ga0466704_480030 | 3300042643 | Bacteria | 3946 |
| 30 | Ga0466709_021217 | 3300042648 | Bacteria | 24774 |
| 31 | Ga0466697_084284 | 3300042611 | Bacteria | 2508 |
| 32 | Ga0466733_171717 | 3300042659 | Bacteria | 27734 |
| 33 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 34 | IMNBL1DRAFT_c0000149 | 3300000062 | Bacteria | 62726 |
| 35 | Ga0466692_118934 | 3300042591 | Unclassified | 3598 |
| 36 | Ga0466701_058955 | 3300042598 | Bacteria | 26869 |
| 37 | Ga0466707_257015 | 3300042601 | Bacteria | 9430 |
| 38 | Ga0466713_002197 | 3300042602 | Bacteria | 31090 |
| 39 | Ga0466713_076063 | 3300042602 | Bacteria | 37576 |
| 40 | Ga0123353_10392226 | 3300010167 | Bacteria | 2071 |
| 41 | Ga0466735_067715 | 3300042624 | Bacteria | 9180 |
| 42 | Ga0466735_174903 | 3300042624 | Bacteria | 2934 |
| 43 | Ga0466727_166040 | 3300042655 | Bacteria | 4754 |
| 44 | Ga0466733_124159 | 3300042659 | Bacteria | 5740 |
| 45 | Ga0072941_1033930 | 3300005201 | Bacteria | 1539 |
| 46 | Ga0466707_022169 | 3300042601 | Bacteria | 38620 |
| 47 | Ga0466707_194051 | 3300042601 | Bacteria | 6556 |
| 48 | Ga0466713_101790 | 3300042602 | Bacteria | 7501 |
| 49 | Ga0466719_382906 | 3300042606 | Bacteria | 2587 |
| 50 | Ga0466698_138024 | 3300042610 | Bacteria | 1726 |
| 51 | Ga0123356_10200050 | 3300010049 | Bacteria | 2037 |
| 52 | Ga0466710_400293 | 3300042613 | Bacteria | 1378 |
| 53 | Ga0466711_007864 | 3300042615 | Bacteria | 9144 |
| 54 | Ga0466711_115858 | 3300042615 | Bacteria | 7719 |
| 55 | Ga0466711_202921 | 3300042615 | Bacteria | 7533 |
| 56 | Ga0466723_018599 | 3300042618 | Bacteria | 4253 |
| 57 | Ga0466735_133959 | 3300042624 | Bacteria | 1352 |
| 58 | Ga0466735_199111 | 3300042624 | Bacteria | 2522 |
| 59 | Ga0466735_203414 | 3300042624 | Bacteria | 4690 |
| 60 | Ga0123357_10002011 | 3300009784 | Bacteria | 22277 |
| 61 | Ga0466692_146630 | 3300042591 | Bacteria | 10066 |
| 62 | Ga0466713_051288 | 3300042602 | Bacteria | 230715 |
| 63 | Ga0466713_111128 | 3300042602 | Bacteria | 15728 |
| 64 | Ga0466716_266440 | 3300042605 | Bacteria | 20602 |
| 65 | Ga0123354_10010376 | 3300010882 | Bacteria | 14348 |
| 66 | Ga0466723_291184 | 3300042618 | Bacteria | 3301 |
| 67 | Ga0466729_314346 | 3300042621 | Bacteria | 10888 |
| 68 | Ga0466735_033158 | 3300042624 | Bacteria | 16684 |
| 69 | Ga0466730_036402 | 3300042625 | Unclassified | 2930 |
| 70 | Ga0466703_107147 | 3300042636 | Bacteria | 8237 |
| 71 | Ga0466707_018222 | 3300042601 | Bacteria | 3994 |
| 72 | Ga0466719_337418 | 3300042606 | Bacteria | 2101 |
| 73 | Ga0123353_10819900 | 3300010167 | Bacteria | 1281 |
| 74 | Ga0466705_404818 | 3300042612 | Unclassified | 11904 |
| 75 | Ga0466705_459208 | 3300042612 | Bacteria | 9399 |
| 76 | Ga0466711_133227 | 3300042615 | Bacteria | 7042 |
| 77 | Ga0466715_107845 | 3300042616 | Bacteria | 5404 |
| 78 | Ga0466715_379015 | 3300042616 | Bacteria | 16425 |
| 79 | Ga0466726_011452 | 3300042619 | Bacteria | 4477 |
| 80 | Ga0466728_106796 | 3300042620 | Bacteria | 2225 |
| 81 | Ga0466729_104723 | 3300042621 | Bacteria | 11891 |
| 82 | Ga0466704_078634 | 3300042643 | Bacteria | 22178 |
| 83 | Ga0466708_221268 | 3300042652 | Bacteria | 13982 |
| 84 | Ga0466727_232178 | 3300042655 | Bacteria | 2869 |
| 85 | IMNBL1DRAFT_c0008823 | 3300000062 | Bacteria | 5079 |
| 86 | Ga0072941_1145795 | 3300005201 | Bacteria | 3745 |
| 87 | Ga0466692_089422 | 3300042591 | Bacteria | 4833 |
| 88 | Ga0466707_194468 | 3300042601 | Bacteria | 43259 |
| 89 | Ga0466714_074216 | 3300042603 | Bacteria | 22640 |
| 90 | Ga0466722_034718 | 3300042609 | Bacteria | 7523 |
| 91 | Ga0123354_10082567 | 3300010882 | Bacteria | 4528 |
| 92 | Ga0466711_216976 | 3300042615 | Bacteria | 6568 |
| 93 | Ga0466715_181089 | 3300042616 | Bacteria | 15777 |
| 94 | Ga0466715_614043 | 3300042616 | Bacteria | 10897 |
| 95 | Ga0466726_010377 | 3300042619 | Bacteria | 10573 |
| 96 | Ga0466729_144058 | 3300042621 | Bacteria | 4770 |
| 97 | Ga0466729_151578 | 3300042621 | Bacteria | 2246 |
| 98 | Ga0466735_205490 | 3300042624 | Bacteria | 2181 |
| 99 | Ga0466709_134637 | 3300042648 | Bacteria | 19759 |
| 100 | Ga0466733_018359 | 3300042659 | Bacteria | 2095 |
| 101 | IMNBL1DRAFT_c0009871 | 3300000062 | Bacteria | 4652 |
| 102 | Ga0123357_10000306 | 3300009784 | Bacteria | 46839 |
| 103 | Ga0466692_116573 | 3300042591 | Bacteria | 8922 |
| 104 | Ga0466691_224364 | 3300042593 | Bacteria | 31650 |
| 105 | Ga0466696_258760 | 3300042596 | Bacteria | 39981 |
| 106 | Ga0466696_373365 | 3300042596 | Bacteria | 17016 |
| 107 | Ga0466713_045750 | 3300042602 | Bacteria | 35229 |
| 108 | Ga0123357_10015185 | 3300009784 | Bacteria | 10091 |
| 109 | Ga0123357_10017659 | 3300009784 | Bacteria | 9452 |
| 110 | Ga0123353_10029439 | 3300010167 | Bacteria | 8463 |
| 111 | Ga0123354_10034204 | 3300010882 | Bacteria | 7948 |
| 112 | Ga0123354_10045502 | 3300010882 | Bacteria | 6716 |
| 113 | Ga0466705_421295 | 3300042612 | Bacteria | 2108 |
| 114 | Ga0466711_341966 | 3300042615 | Bacteria | 7398 |
| 115 | Ga0466729_175447 | 3300042621 | Bacteria | 4603 |
| 116 | Ga0466735_059305 | 3300042624 | Bacteria | 1413 |
| 117 | Ga0466704_089150 | 3300042643 | Bacteria | 4526 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF00288 | GO:0005524 | ATP binding | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.