Protein Family IF03495
Metagenome
Isolate
138
Members
38
Samples
128
Scaffolds
264.01
Avg Length
Representative Sequence
- ID
- 3300010882|Ga0123354_10065571|Ga0123354_100655715
- Length
- 299 aa
- Sequence
- VRTTTSEILSIKDLSKAYNSKDSKALKNVSITVESGEFISVIGPSGAGKSTLLRCINRMVDATEGEIVFNGQNISKVKGKALRVVRTNIGMIFQNYNLVNRLSVLENVLHGRLGYKSTISGALGFYSEAEKEKAFEIISRLGLIKHAYKRCDELSGGQKQRVGIARALMQDPQLILCDEPIASLDPNSSKVIMDYLQDINRAMKITCIVNLHQVDFACKYAERIIGINNGAIVYDGSAKTISQSDLKAIYESDQESYINDAGYSCQELVVTTANATKQVLETNKITLNEKHLVYEKHY*
Sample Types
Isolate
7.2%
Metagenome
92.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
36.1%
Kalotermitidae
36.1%
Unclassified
22.2%
Penaeidae
2.8%
Rhinotermitidae
2.8%
Taxonomy
Archaea
0
Bacteria
134
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820833147 | Unclassified Actinobacteria Lab288P4bin85 | Isolate | Unclassified |
| 2 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 3 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 4 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 5 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 6 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 7 | 8082023105 | Niallia sp. Man26 | Isolate | Penaeidae |
| 8 | 8114537524 | Enterococcus sp. 12C11_DIV0727 12C11_DIV0727 | Isolate | |
| 9 | 2820909719 | Unclassified Actinobacteria Emb289P4bin20 | Isolate | Unclassified |
| 10 | 2820422691 | Unclassified Firmicutes Lab288P3bin58 | Isolate | Unclassified |
| 11 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 12 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 13 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 14 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 15 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 16 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 17 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 18 | 2820698910 | Unclassified Firmicutes Co191P1bin64 | Isolate | Unclassified |
| 19 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 20 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 21 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 22 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 23 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 24 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 25 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 26 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 27 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 28 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 29 | 2820663833 | Unclassified Firmicutes Co191P3bin41 | Isolate | Unclassified |
| 30 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 31 | 2873597894 | Erysipelothrix sp. HDW6B | Isolate | Unclassified |
| 32 | 2781125631 | Treponema sp. Nt197P3bin89 | Isolate | Unclassified |
| 33 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 34 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 35 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 36 | 2843246524 | Lysinibacillus sphaericus DSM 28 | Isolate | Unclassified |
| 37 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 38 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_236602 | 3300042612 | Bacteria | 26817 |
| 2 | Ga0466715_244159 | 3300042616 | Bacteria | 31385 |
| 3 | Ga0466723_325484 | 3300042618 | Bacteria | 4461 |
| 4 | Ga0466723_345541 | 3300042618 | Bacteria | 8295 |
| 5 | Ga0123356_10800191 | 3300010049 | Bacteria | 1114 |
| 6 | Ga0466720_108039 | 3300042607 | Bacteria | 13191 |
| 7 | JGI24695J34938_10000077 | 3300002450 | Bacteria | 83455 |
| 8 | Ga0466691_010447 | 3300042593 | Bacteria | 1818 |
| 9 | Ga0466691_137048 | 3300042593 | Bacteria | 28584 |
| 10 | Ga0466703_268818 | 3300042636 | Bacteria | 5406 |
| 11 | Ga0466703_381334 | 3300042636 | Bacteria | 10561 |
| 12 | Ga0466704_387524 | 3300042643 | Bacteria | 3470 |
| 13 | Ga0466709_223746 | 3300042648 | Bacteria | 4167 |
| 14 | Ga0466708_121783 | 3300042652 | Bacteria | 2339 |
| 15 | Ga0466711_054990 | 3300042615 | Bacteria | 8308 |
| 16 | Ga0466723_026563 | 3300042618 | Bacteria | 110971 |
| 17 | Ga0466723_148005 | 3300042618 | Bacteria | 27024 |
| 18 | Ga0466723_200185 | 3300042618 | Bacteria | 12692 |
| 19 | Ga0123353_10259113 | 3300010167 | Bacteria | 2688 |
| 20 | Ga0123353_10647830 | 3300010167 | Bacteria | 1496 |
| 21 | Ga0466719_333256 | 3300042606 | Unclassified | 2380 |
| 22 | Ga0466719_387724 | 3300042606 | Bacteria | 2938 |
| 23 | Ga0466692_191585 | 3300042591 | Bacteria | 1086 |
| 24 | Ga0466731_199636 | 3300042622 | Bacteria | 3301 |
| 25 | Ga0466704_031627 | 3300042643 | Bacteria | 4631 |
| 26 | Ga0466704_057369 | 3300042643 | Bacteria | 3692 |
| 27 | Ga0466709_390168 | 3300042648 | Bacteria | 3676 |
| 28 | Ga0466711_022754 | 3300042615 | Bacteria | 3505 |
| 29 | Ga0466715_077102 | 3300042616 | Bacteria | 10738 |
| 30 | Ga0466728_272307 | 3300042620 | Bacteria | 6898 |
| 31 | Ga0123357_10077910 | 3300009784 | Bacteria | 4370 |
| 32 | Ga0123354_10000071 | 3300010882 | Bacteria | 76954 |
| 33 | Ga0466716_445839 | 3300042605 | Unclassified | 1707 |
| 34 | Ga0466716_503323 | 3300042605 | Bacteria | 8608 |
| 35 | Ga0466716_542890 | 3300042605 | Bacteria | 1243 |
| 36 | Ga0466690_051266 | 3300042590 | Bacteria | 2284 |
| 37 | Ga0466690_094725 | 3300042590 | Bacteria | 4188 |
| 38 | Ga0466699_211020 | 3300042597 | Bacteria | 2132 |
| 39 | Ga0466703_127939 | 3300042636 | Bacteria | 32645 |
| 40 | Ga0466703_362285 | 3300042636 | Bacteria | 1058 |
| 41 | Ga0466703_415436 | 3300042636 | Bacteria | 2706 |
| 42 | Ga0466704_166993 | 3300042643 | Bacteria | 2836 |
| 43 | Ga0466704_223982 | 3300042643 | Bacteria | 3430 |
| 44 | Ga0466709_143033 | 3300042648 | Bacteria | 14752 |
| 45 | Ga0466708_161973 | 3300042652 | Bacteria | 41034 |
| 46 | Ga0466708_171619 | 3300042652 | Bacteria | 15797 |
| 47 | Ga0466708_328975 | 3300042652 | Bacteria | 16368 |
| 48 | Ga0466705_045928 | 3300042612 | Bacteria | 4369 |
| 49 | Ga0466705_096074 | 3300042612 | Bacteria | 2754 |
| 50 | Ga0466723_078936 | 3300042618 | Bacteria | 9831 |
| 51 | Ga0466723_170171 | 3300042618 | Bacteria | 4394 |
| 52 | Ga0466723_243195 | 3300042618 | Bacteria | 87629 |
| 53 | Ga0466723_318990 | 3300042618 | Bacteria | 1585 |
| 54 | Ga0466728_128904 | 3300042620 | Bacteria | 5682 |
| 55 | Ga0466728_390232 | 3300042620 | Bacteria | 5979 |
| 56 | Ga0123357_10093667 | 3300009784 | Bacteria | 3903 |
| 57 | Ga0123355_10002922 | 3300009826 | Bacteria | 24284 |
| 58 | Ga0123355_10004337 | 3300009826 | Bacteria | 20628 |
| 59 | Ga0123355_10561238 | 3300009826 | Bacteria | 1375 |
| 60 | Ga0123354_10065571 | 3300010882 | Bacteria | 5313 |
| 61 | Ga0123354_10102756 | 3300010882 | Bacteria | 3849 |
| 62 | Ga0466717_183663 | 3300042604 | Unclassified | 1570 |
| 63 | Ga0466716_057704 | 3300042605 | Bacteria | 22306 |
| 64 | AustNasuHG_c1004224 | 3300000089 | Bacteria | 5157 |
| 65 | Ga0466690_049371 | 3300042590 | Bacteria | 5349 |
| 66 | Ga0466691_028713 | 3300042593 | Bacteria | 11625 |
| 67 | Ga0466703_330833 | 3300042636 | Bacteria | 14129 |
| 68 | Ga0466703_413259 | 3300042636 | Bacteria | 2331 |
| 69 | Ga0466709_165042 | 3300042648 | Bacteria | 6881 |
| 70 | Ga0466709_390021 | 3300042648 | Bacteria | 2887 |
| 71 | Ga0466709_404141 | 3300042648 | Bacteria | 3159 |
| 72 | Ga0466732_081713 | 3300042656 | Bacteria | 4301 |
| 73 | Ga0466711_026376 | 3300042615 | Bacteria | 5079 |
| 74 | Ga0466711_138665 | 3300042615 | Bacteria | 5456 |
| 75 | Ga0466715_030227 | 3300042616 | Bacteria | 24248 |
| 76 | Ga0466723_051811 | 3300042618 | Bacteria | 1917 |
| 77 | Ga0466723_213834 | 3300042618 | Bacteria | 8852 |
| 78 | Ga0466723_244080 | 3300042618 | Bacteria | 15547 |
| 79 | Ga0466728_390942 | 3300042620 | Bacteria | 2096 |
| 80 | Ga0123357_10050049 | 3300009784 | Bacteria | 5657 |
| 81 | Ga0466719_369321 | 3300042606 | Bacteria | 1187 |
| 82 | AustNasuHG_c1022420 | 3300000089 | Bacteria | 2028 |
| 83 | Ga0072941_1013479 | 3300005201 | Bacteria | 12277 |
| 84 | Ga0466691_096810 | 3300042593 | Bacteria | 2881 |
| 85 | Ga0466703_036839 | 3300042636 | Bacteria | 7162 |
| 86 | Ga0466709_160787 | 3300042648 | Bacteria | 4895 |
| 87 | Ga0466709_230639 | 3300042648 | Bacteria | 5628 |
| 88 | Ga0466705_203339 | 3300042612 | Bacteria | 4151 |
| 89 | Ga0466715_162008 | 3300042616 | Bacteria | 2734 |
| 90 | Ga0466723_141391 | 3300042618 | Bacteria | 24854 |
| 91 | Ga0466723_370110 | 3300042618 | Bacteria | 1604 |
| 92 | Ga0466728_068200 | 3300042620 | Bacteria | 4712 |
| 93 | Ga0123357_10006340 | 3300009784 | Bacteria | 14408 |
| 94 | Ga0123356_10073986 | 3300010049 | Bacteria | 3205 |
| 95 | Ga0123353_10270168 | 3300010167 | Unclassified | 2620 |
| 96 | Ga0123353_10312042 | 3300010167 | Bacteria | 2392 |
| 97 | Ga0123353_10907196 | 3300010167 | Bacteria | 1199 |
| 98 | Ga0466704_153272 | 3300042643 | Bacteria | 24613 |
| 99 | Ga0466708_159795 | 3300042652 | Bacteria | 18178 |
| 100 | Ga0466711_456831 | 3300042615 | Bacteria | 1949 |
| 101 | Ga0466715_019276 | 3300042616 | Bacteria | 18285 |
| 102 | Ga0466723_342913 | 3300042618 | Bacteria | 10032 |
| 103 | Ga0466728_065780 | 3300042620 | Bacteria | 4350 |
| 104 | Ga0123357_10226069 | 3300009784 | Bacteria | 2064 |
| 105 | Ga0123353_10429917 | 3300010167 | Bacteria | 1953 |
| 106 | Ga0123353_11240888 | 3300010167 | Bacteria | 974 |
| 107 | Ga0123354_10335884 | 3300010882 | Bacteria | 1370 |
| 108 | Ga0466690_004222 | 3300042590 | Bacteria | 1514 |
| 109 | Ga0466692_062291 | 3300042591 | Bacteria | 3411 |
| 110 | Ga0466691_073857 | 3300042593 | Bacteria | 12152 |
| 111 | Ga0466708_063693 | 3300042652 | Bacteria | 2304 |
| 112 | Ga0466708_252652 | 3300042652 | Bacteria | 4384 |
| 113 | Ga0466705_308711 | 3300042612 | Bacteria | 4351 |
| 114 | Ga0466705_522651 | 3300042612 | Bacteria | 30673 |
| 115 | Ga0466723_050687 | 3300042618 | Bacteria | 1913 |
| 116 | Ga0466723_175933 | 3300042618 | Bacteria | 11294 |
| 117 | Ga0466728_056223 | 3300042620 | Bacteria | 10745 |
| 118 | Ga0466728_171780 | 3300042620 | Bacteria | 1766 |
| 119 | Ga0123357_10196649 | 3300009784 | Bacteria | 2307 |
| 120 | Ga0123355_10006535 | 3300009826 | Bacteria | 17296 |
| 121 | Ga0123353_10018517 | 3300010167 | Bacteria | 10300 |
| 122 | Ga0123353_10145836 | 3300010167 | Bacteria | 3785 |
| 123 | Ga0466719_345548 | 3300042606 | Bacteria | 4916 |
| 124 | Ga0415639_096628 | 3300038395 | Bacteria | 1733 |
| 125 | Ga0466690_138899 | 3300042590 | Bacteria | 1134 |
| 126 | Ga0466691_060371 | 3300042593 | Bacteria | 20351 |
| 127 | Ga0466703_272627 | 3300042636 | Bacteria | 11884 |
| 128 | Ga0466704_096911 | 3300042643 | Bacteria | 3491 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00005 | ABC_tran | ABC transporter | 26 | 182 | 0.98 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.