Protein Family IF03396
Metagenome
Isolate
116
Members
48
Samples
113
Scaffolds
124.19
Avg Length
Representative Sequence
- ID
- 3300010167|Ga0123353_11444639|Ga0123353_114446391
- Length
- 150 aa
- Sequence
- MPLNENDLSFLIDILDCINDIKEFTEEIQFNEFQKDKMRKLAVERQLEVIGQAANKITKETQDVLRNIPWMNIIGLRNKLAHDYGEILAERIWIIVKKSIQELLDELLKIISVQNKSSVYHVNSKWYCSTCLGFDVGLLPHTKSYKDIR*
Sample Types
Isolate
1.7%
Metagenome
98.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
53.2%
Kalotermitidae
27.7%
Rhinotermitidae
6.4%
Termopsidae
6.4%
Unclassified
6.4%
Taxonomy
Archaea
0
Bacteria
97
Eukaryota
0
Viruses
0
Unclassified
19
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 2 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 3 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 4 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 5 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 6 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 7 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 8 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 9 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 10 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 11 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 12 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 13 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 14 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 15 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 16 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 17 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 18 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 19 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 20 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 21 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 22 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 23 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 24 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 25 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 26 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 27 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 28 | 2781125659 | Treponema sp. Emb289P3bin114 | Isolate | Unclassified |
| 29 | 2820021908 | Unclassified Spirochaetes Lab288P4bin6 | Isolate | Unclassified |
| 30 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 31 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 32 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 33 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 34 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 35 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 36 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 37 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 38 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 39 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 40 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 41 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 42 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 43 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 44 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 45 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 46 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 47 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 48 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466731_189371 | 3300042622 | Bacteria | 1422 |
| 2 | Ga0466735_132323 | 3300042624 | Bacteria | 1142 |
| 3 | Ga0466703_256146 | 3300042636 | Unclassified | 1017 |
| 4 | Ga0466727_213224 | 3300042655 | Bacteria | 1044 |
| 5 | Ga0123355_11821193 | 3300009826 | Unclassified | 573 |
| 6 | Ga0466699_153545 | 3300042597 | Bacteria | 2239 |
| 7 | JGI24698J34947_10012873 | 3300002449 | Unclassified | 4572 |
| 8 | JGI24698J34947_10208590 | 3300002449 | Bacteria | 759 |
| 9 | Ga0466720_198859 | 3300042607 | Bacteria | 1070 |
| 10 | Ga0466721_160171 | 3300042608 | Bacteria | 3041 |
| 11 | Ga0466732_145255 | 3300042656 | Bacteria | 6349 |
| 12 | Ga0466709_168474 | 3300042648 | Bacteria | 1038 |
| 13 | Ga0123353_10006035 | 3300010167 | Bacteria | 16053 |
| 14 | Ga0123353_11131698 | 3300010167 | Bacteria | 1035 |
| 15 | JGI24698J34947_10048075 | 3300002449 | Bacteria | 2162 |
| 16 | Ga0466716_186771 | 3300042605 | Bacteria | 1344 |
| 17 | Ga0466720_095134 | 3300042607 | Unclassified | 1553 |
| 18 | Ga0466721_108087 | 3300042608 | Bacteria | 1866 |
| 19 | Ga0466732_449292 | 3300042656 | Bacteria | 1570 |
| 20 | Ga0466702_246718 | 3300042635 | Bacteria | 1081 |
| 21 | Ga0466704_156704 | 3300042643 | Bacteria | 2774 |
| 22 | Ga0466704_551457 | 3300042643 | Bacteria | 3028 |
| 23 | Ga0466726_115686 | 3300042619 | Bacteria | 2111 |
| 24 | Ga0123355_10135429 | 3300009826 | Bacteria | 3784 |
| 25 | Ga0123356_10547341 | 3300010049 | Bacteria | 1318 |
| 26 | Ga0466694_027240 | 3300042594 | Bacteria | 14900 |
| 27 | Ga0466696_037113 | 3300042596 | Bacteria | 1200 |
| 28 | Ga0466699_139973 | 3300042597 | Unclassified | 2119 |
| 29 | JGI24702J35022_10221302 | 3300002462 | Bacteria | 1091 |
| 30 | JGI24697J35500_11260404 | 3300002507 | Bacteria | 2980 |
| 31 | Ga0466707_111167 | 3300042601 | Bacteria | 1500 |
| 32 | Ga0466719_236796 | 3300042606 | Bacteria | 1055 |
| 33 | Ga0466704_068187 | 3300042643 | Bacteria | 1904 |
| 34 | Ga0466709_034329 | 3300042648 | Bacteria | 2029 |
| 35 | Ga0466727_073954 | 3300042655 | Unclassified | 1713 |
| 36 | Ga0466710_003998 | 3300042613 | Bacteria | 1367 |
| 37 | Ga0466712_010651 | 3300042614 | Bacteria | 1076 |
| 38 | Ga0466712_015577 | 3300042614 | Bacteria | 2068 |
| 39 | Ga0466712_041536 | 3300042614 | Bacteria | 4128 |
| 40 | Ga0466711_110779 | 3300042615 | Bacteria | 1506 |
| 41 | Ga0466718_003272 | 3300042617 | Bacteria | 2136 |
| 42 | Ga0466718_012124 | 3300042617 | Bacteria | 8319 |
| 43 | Ga0466728_076026 | 3300042620 | Bacteria | 1833 |
| 44 | Ga0123356_10002538 | 3300010049 | Bacteria | 19522 |
| 45 | Ga0123353_10985363 | 3300010167 | Bacteria | 1135 |
| 46 | Ga0466694_065781 | 3300042594 | Bacteria | 2396 |
| 47 | Ga0466694_135781 | 3300042594 | Bacteria | 3169 |
| 48 | AustNasuHG_c1046530 | 3300000089 | Bacteria | 978 |
| 49 | Ga0466707_419362 | 3300042601 | Bacteria | 1400 |
| 50 | Ga0466721_122088 | 3300042608 | Bacteria | 5774 |
| 51 | Ga0466722_080222 | 3300042609 | Bacteria | 7965 |
| 52 | Ga0466732_239270 | 3300042656 | Bacteria | 4372 |
| 53 | Ga0466702_371808 | 3300042635 | Bacteria | 1542 |
| 54 | Ga0466708_270543 | 3300042652 | Bacteria | 1455 |
| 55 | Ga0466727_042862 | 3300042655 | Bacteria | 1155 |
| 56 | Ga0466718_077315 | 3300042617 | Bacteria | 2717 |
| 57 | Ga0466723_015195 | 3300042618 | Bacteria | 2434 |
| 58 | Ga0123355_10119001 | 3300009826 | Bacteria | 4102 |
| 59 | Ga0466699_313049 | 3300042597 | Bacteria | 1101 |
| 60 | JGI24698J34947_10025558 | 3300002449 | Bacteria | 3143 |
| 61 | JGI24698J34947_10105404 | 3300002449 | Bacteria | 1257 |
| 62 | JGI24695J34938_10121789 | 3300002450 | Bacteria | 1062 |
| 63 | JGI24702J35022_10063696 | 3300002462 | Bacteria | 1976 |
| 64 | Ga0466729_277774 | 3300042621 | Bacteria | 1321 |
| 65 | Ga0466735_004233 | 3300042624 | Bacteria | 1283 |
| 66 | Ga0466702_338921 | 3300042635 | Bacteria | 1497 |
| 67 | Ga0466712_186999 | 3300042614 | Bacteria | 3930 |
| 68 | Ga0466723_011150 | 3300042618 | Unclassified | 7703 |
| 69 | Ga0466726_329199 | 3300042619 | Bacteria | 1836 |
| 70 | Ga0123356_10000596 | 3300010049 | Bacteria | 40097 |
| 71 | Ga0123356_11621615 | 3300010049 | Bacteria | 801 |
| 72 | Ga0466692_129496 | 3300042591 | Bacteria | 3401 |
| 73 | Ga0466695_318665 | 3300042595 | Bacteria | 2990 |
| 74 | JGI24698J34947_10033660 | 3300002449 | Bacteria | 2686 |
| 75 | JGI24698J34947_10066517 | 3300002449 | Bacteria | 1753 |
| 76 | JGI24698J34947_10092521 | 3300002449 | Unclassified | 1382 |
| 77 | Ga0466717_065388 | 3300042604 | Bacteria | 1069 |
| 78 | Ga0466716_086337 | 3300042605 | Bacteria | 7853 |
| 79 | Ga0466720_086369 | 3300042607 | Unclassified | 1731 |
| 80 | Ga0466721_043416 | 3300042608 | Unclassified | 1061 |
| 81 | Ga0466705_270568 | 3300042612 | Bacteria | 2015 |
| 82 | Ga0466733_138921 | 3300042659 | Bacteria | 5197 |
| 83 | Ga0466735_136469 | 3300042624 | Bacteria | 1045 |
| 84 | Ga0466703_237918 | 3300042636 | Bacteria | 2424 |
| 85 | Ga0466712_033783 | 3300042614 | Bacteria | 1091 |
| 86 | Ga0466715_443349 | 3300042616 | Bacteria | 2009 |
| 87 | Ga0466718_144639 | 3300042617 | Bacteria | 5446 |
| 88 | Ga0123356_11763196 | 3300010049 | Unclassified | 769 |
| 89 | Ga0123353_10917333 | 3300010167 | Bacteria | 1190 |
| 90 | Ga0123353_11444639 | 3300010167 | Bacteria | 880 |
| 91 | Ga0123354_10720068 | 3300010882 | Unclassified | 692 |
| 92 | Ga0466693_201209 | 3300042592 | Bacteria | 1570 |
| 93 | Ga0466694_286447 | 3300042594 | Bacteria | 1272 |
| 94 | JGI24695J34938_10188636 | 3300002450 | Unclassified | 855 |
| 95 | Ga0466720_071130 | 3300042607 | Bacteria | 2379 |
| 96 | Ga0466720_095591 | 3300042607 | Bacteria | 2091 |
| 97 | Ga0466698_031581 | 3300042610 | Unclassified | 1203 |
| 98 | Ga0466733_165774 | 3300042659 | Bacteria | 2961 |
| 99 | Ga0466731_044838 | 3300042622 | Unclassified | 1035 |
| 100 | Ga0466702_251464 | 3300042635 | Bacteria | 1466 |
| 101 | Ga0466727_244120 | 3300042655 | Bacteria | 2912 |
| 102 | Ga0466728_056329 | 3300042620 | Bacteria | 3000 |
| 103 | Ga0123356_11730214 | 3300010049 | Unclassified | 776 |
| 104 | Ga0264413_110743 | 3300024493 | Unclassified | 2059 |
| 105 | Ga0466690_329729 | 3300042590 | Bacteria | 1246 |
| 106 | Ga0466696_268702 | 3300042596 | Unclassified | 1394 |
| 107 | Ga0466699_046149 | 3300042597 | Bacteria | 1404 |
| 108 | Ga0466699_441790 | 3300042597 | Bacteria | 2722 |
| 109 | AustNasuHG_c1035472 | 3300000089 | Bacteria | 1313 |
| 110 | JGI24698J34947_10003634 | 3300002449 | Bacteria | 8379 |
| 111 | JGI24696J40584_12910625 | 3300002834 | Bacteria | 1253 |
| 112 | Ga0466719_239413 | 3300042606 | Bacteria | 2023 |
| 113 | Ga0466721_219266 | 3300042608 | Unclassified | 1080 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01934 | HepT-like | Ribonuclease HepT-like | 14 | 109 | 0.97 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.