Protein Family IF03335
Metagenome
Isolate
164
Members
46
Samples
159
Scaffolds
321.1
Avg Length
Representative Sequence
- ID
- 3300010167|Ga0123353_10656617|Ga0123353_106566172
- Length
- 362 aa
- Sequence
- LAAGDSGFCDTRGDHYQCDDQAEPRPNYTAPKGDIGGAMAEKTLSIQKPWSWKQFFFQWEWLLALIFILVNVINSIISPYYLNAGVFLNAPMNFLDKAFIVFPMMLVIMLGRIDISVSSNVALTSVLMAVLYNTGLPMPLALLAALLIGAALGGVTSLLQIKFPELPAMIVTLAAMIIYRGVAYVILQDKASSGFPEWFSFFAWGYVGPFPFILIVFAVVAVIFGIVIHKTGFGRTVYGMGSNLLACKYSGVKTDRVLMIVGLLTGLMCGVCAIFLTSRMGSTRPNIATGYELEVIAMVVLGGVSTSGGTGRIAGPLLAVFVIGFLNYGLGLMNIASQALLIIVGLLLILSVLVMNLRIKK*
Sample Types
Isolate
3.0%
Metagenome
97.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
44.4%
Kalotermitidae
31.1%
Unclassified
11.1%
Termopsidae
6.7%
Rhinotermitidae
4.4%
Scarabaeidae
2.2%
Taxonomy
Archaea
0
Bacteria
151
Eukaryota
0
Viruses
0
Unclassified
13
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2731957677 | Alkalihalobacillus trypoxylicola NBRC 102646 | Isolate | Scarabaeidae |
| 2 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 3 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 4 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 5 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 6 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 7 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 8 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 9 | 2781125629 | Treponema sp. Nt197P3bin20 | Isolate | Unclassified |
| 10 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 11 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 12 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 13 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 14 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 15 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 16 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 17 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 18 | 2781125630 | Treponema sp. Nt197P3bin60 | Isolate | Unclassified |
| 19 | 2781125693 | Treponema sp. Th196P3bin148 | Isolate | Unclassified |
| 20 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 21 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 22 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 23 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 24 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 25 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 26 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 27 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 28 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 29 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 30 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 31 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 32 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 33 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 34 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 35 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 36 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 37 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 38 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 39 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 40 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 41 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 42 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 43 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 44 | 2819994798 | Unclassified Spirochaetes Th196P1bin3 | Isolate | Unclassified |
| 45 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 46 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_229487 | 3300042612 | Bacteria | 9029 |
| 2 | Ga0466705_247175 | 3300042612 | Bacteria | 6140 |
| 3 | Ga0466705_348785 | 3300042612 | Bacteria | 46858 |
| 4 | Ga0466732_137461 | 3300042656 | Bacteria | 5460 |
| 5 | Ga0466732_227501 | 3300042656 | Bacteria | 3292 |
| 6 | Ga0466716_487633 | 3300042605 | Unclassified | 2831 |
| 7 | Ga0466716_524264 | 3300042605 | Bacteria | 3366 |
| 8 | Ga0466720_231306 | 3300042607 | Bacteria | 3707 |
| 9 | Ga0466712_159989 | 3300042614 | Unclassified | 1368 |
| 10 | Ga0466715_029661 | 3300042616 | Bacteria | 14479 |
| 11 | Ga0466715_092390 | 3300042616 | Bacteria | 8687 |
| 12 | Ga0466715_117066 | 3300042616 | Bacteria | 10570 |
| 13 | Ga0466723_192604 | 3300042618 | Unclassified | 1269 |
| 14 | Ga0466726_289984 | 3300042619 | Bacteria | 1746 |
| 15 | Ga0466726_308546 | 3300042619 | Bacteria | 3242 |
| 16 | Ga0264413_146090 | 3300024493 | Bacteria | 3040 |
| 17 | Ga0466690_003223 | 3300042590 | Bacteria | 10701 |
| 18 | Ga0466694_155148 | 3300042594 | Bacteria | 33595 |
| 19 | Ga0466694_392238 | 3300042594 | Bacteria | 3118 |
| 20 | Ga0466696_014933 | 3300042596 | Unclassified | 2494 |
| 21 | Ga0466703_332825 | 3300042636 | Bacteria | 6732 |
| 22 | Ga0466708_073807 | 3300042652 | Bacteria | 5081 |
| 23 | Ga0466708_294057 | 3300042652 | Bacteria | 6979 |
| 24 | Ga0123357_10013404 | 3300009784 | Bacteria | 10640 |
| 25 | Ga0123353_10707789 | 3300010167 | Bacteria | 1412 |
| 26 | Ga0466705_321082 | 3300042612 | Bacteria | 4628 |
| 27 | Ga0466707_239694 | 3300042601 | Bacteria | 2577 |
| 28 | Ga0466722_012969 | 3300042609 | Bacteria | 7839 |
| 29 | Ga0466711_309380 | 3300042615 | Bacteria | 9841 |
| 30 | Ga0466711_367078 | 3300042615 | Bacteria | 4888 |
| 31 | Ga0466711_512684 | 3300042615 | Bacteria | 9534 |
| 32 | Ga0466723_217029 | 3300042618 | Bacteria | 6535 |
| 33 | Ga0466731_416434 | 3300042622 | Bacteria | 1305 |
| 34 | Ga0466703_039954 | 3300042636 | Bacteria | 32713 |
| 35 | Ga0466704_236505 | 3300042643 | Bacteria | 15020 |
| 36 | Ga0466704_365010 | 3300042643 | Bacteria | 2764 |
| 37 | Ga0466704_499057 | 3300042643 | Bacteria | 60887 |
| 38 | AustNasuHG_c1001812 | 3300000089 | Bacteria | 7726 |
| 39 | JGI24698J34947_10005927 | 3300002449 | Bacteria | 6703 |
| 40 | Ga0466732_033043 | 3300042656 | Bacteria | 1587 |
| 41 | Ga0466701_034158 | 3300042598 | Bacteria | 2601 |
| 42 | Ga0466700_094570 | 3300042600 | Bacteria | 3922 |
| 43 | Ga0466719_126527 | 3300042606 | Bacteria | 12884 |
| 44 | Ga0466711_325368 | 3300042615 | Bacteria | 3524 |
| 45 | Ga0466715_015876 | 3300042616 | Bacteria | 7726 |
| 46 | Ga0466718_007983 | 3300042617 | Bacteria | 11353 |
| 47 | Ga0466718_149828 | 3300042617 | Bacteria | 1737 |
| 48 | Ga0466723_157692 | 3300042618 | Bacteria | 11721 |
| 49 | Ga0466690_133902 | 3300042590 | Unclassified | 1530 |
| 50 | Ga0466703_062086 | 3300042636 | Bacteria | 35310 |
| 51 | Ga0466703_071234 | 3300042636 | Bacteria | 32935 |
| 52 | Ga0466704_181861 | 3300042643 | Bacteria | 1282 |
| 53 | Ga0466704_392671 | 3300042643 | Bacteria | 4510 |
| 54 | Ga0466727_024233 | 3300042655 | Bacteria | 3718 |
| 55 | Ga0123357_10032769 | 3300009784 | Bacteria | 7058 |
| 56 | Ga0123353_10153798 | 3300010167 | Bacteria | 3670 |
| 57 | Ga0123353_10231343 | 3300010167 | Bacteria | 2881 |
| 58 | Ga0466705_161115 | 3300042612 | Bacteria | 6549 |
| 59 | Ga0466733_084293 | 3300042659 | Bacteria | 10083 |
| 60 | Ga0466717_018391 | 3300042604 | Bacteria | 1103 |
| 61 | Ga0466719_126368 | 3300042606 | Bacteria | 8275 |
| 62 | Ga0466722_046317 | 3300042609 | Bacteria | 10772 |
| 63 | Ga0466722_109095 | 3300042609 | Bacteria | 5639 |
| 64 | Ga0466715_104988 | 3300042616 | Bacteria | 7630 |
| 65 | Ga0466715_276095 | 3300042616 | Bacteria | 16435 |
| 66 | Ga0466715_337385 | 3300042616 | Bacteria | 28368 |
| 67 | Ga0466715_352368 | 3300042616 | Bacteria | 41831 |
| 68 | Ga0466723_005326 | 3300042618 | Bacteria | 6054 |
| 69 | Ga0466692_188577 | 3300042591 | Bacteria | 2976 |
| 70 | Ga0466691_142836 | 3300042593 | Bacteria | 24101 |
| 71 | Ga0466691_216648 | 3300042593 | Bacteria | 4893 |
| 72 | Ga0466696_243964 | 3300042596 | Bacteria | 16610 |
| 73 | Ga0466704_249516 | 3300042643 | Bacteria | 1732 |
| 74 | Ga0466708_313738 | 3300042652 | Bacteria | 34279 |
| 75 | Ga0466727_190677 | 3300042655 | Bacteria | 3724 |
| 76 | Ga0123357_10071409 | 3300009784 | Bacteria | 4604 |
| 77 | Ga0466705_068030 | 3300042612 | Bacteria | 27444 |
| 78 | Ga0466705_216735 | 3300042612 | Bacteria | 10484 |
| 79 | Ga0466700_110693 | 3300042600 | Bacteria | 2109 |
| 80 | Ga0466716_057758 | 3300042605 | Bacteria | 2808 |
| 81 | Ga0466719_254442 | 3300042606 | Bacteria | 20977 |
| 82 | Ga0466711_032012 | 3300042615 | Bacteria | 13247 |
| 83 | Ga0466715_192223 | 3300042616 | Bacteria | 3594 |
| 84 | Ga0466691_012570 | 3300042593 | Bacteria | 32910 |
| 85 | Ga0466691_013607 | 3300042593 | Unclassified | 2072 |
| 86 | Ga0466696_279697 | 3300042596 | Bacteria | 2984 |
| 87 | Ga0466735_050164 | 3300042624 | Bacteria | 20969 |
| 88 | Ga0466704_115918 | 3300042643 | Unclassified | 4540 |
| 89 | Ga0466704_559996 | 3300042643 | Bacteria | 2176 |
| 90 | Ga0466709_265960 | 3300042648 | Bacteria | 10518 |
| 91 | Ga0466708_246011 | 3300042652 | Bacteria | 47079 |
| 92 | Ga0466708_327322 | 3300042652 | Bacteria | 4193 |
| 93 | Ga0466727_170013 | 3300042655 | Bacteria | 1725 |
| 94 | Ga0466727_218481 | 3300042655 | Bacteria | 19155 |
| 95 | Ga0123357_10115749 | 3300009784 | Bacteria | 3398 |
| 96 | Ga0123353_10656617 | 3300010167 | Bacteria | 1483 |
| 97 | Ga0466705_245554 | 3300042612 | Bacteria | 9805 |
| 98 | Ga0466733_202852 | 3300042659 | Bacteria | 5392 |
| 99 | Ga0466719_031011 | 3300042606 | Bacteria | 8405 |
| 100 | Ga0466715_126460 | 3300042616 | Bacteria | 2517 |
| 101 | Ga0466715_210750 | 3300042616 | Bacteria | 13270 |
| 102 | Ga0466726_185739 | 3300042619 | Bacteria | 5905 |
| 103 | Ga0466726_326083 | 3300042619 | Bacteria | 9566 |
| 104 | Ga0466728_043318 | 3300042620 | Bacteria | 1770 |
| 105 | Ga0466728_446107 | 3300042620 | Bacteria | 10681 |
| 106 | Ga0466690_014464 | 3300042590 | Bacteria | 11796 |
| 107 | Ga0466696_127694 | 3300042596 | Bacteria | 5067 |
| 108 | Ga0466696_134615 | 3300042596 | Unclassified | 1607 |
| 109 | Ga0466696_434531 | 3300042596 | Bacteria | 2827 |
| 110 | Ga0466731_160002 | 3300042622 | Bacteria | 1234 |
| 111 | Ga0466703_099040 | 3300042636 | Bacteria | 5331 |
| 112 | Ga0466704_268625 | 3300042643 | Bacteria | 59494 |
| 113 | Ga0466709_267702 | 3300042648 | Bacteria | 14355 |
| 114 | Ga0466708_319825 | 3300042652 | Unclassified | 1892 |
| 115 | Ga0466727_080537 | 3300042655 | Bacteria | 3297 |
| 116 | Ga0466727_174028 | 3300042655 | Bacteria | 2254 |
| 117 | Ga0123355_10003085 | 3300009826 | Bacteria | 23756 |
| 118 | AustNasuHG_c1000592 | 3300000089 | Bacteria | 12795 |
| 119 | AustNasuHG_c1002678 | 3300000089 | Bacteria | 6431 |
| 120 | JGI24698J34947_10005126 | 3300002449 | Bacteria | 7175 |
| 121 | JGI24695J34938_10081226 | 3300002450 | Bacteria | 1339 |
| 122 | JGI24702J35022_10001060 | 3300002462 | Bacteria | 17188 |
| 123 | JGI24700J35501_10930275 | 3300002508 | Bacteria | 12671 |
| 124 | Ga0072940_1040449 | 3300005200 | Unclassified | 2564 |
| 125 | Ga0466705_020647 | 3300042612 | Bacteria | 15474 |
| 126 | Ga0466716_061126 | 3300042605 | Bacteria | 6240 |
| 127 | Ga0466719_353863 | 3300042606 | Bacteria | 1292 |
| 128 | Ga0466705_474230 | 3300042612 | Bacteria | 3028 |
| 129 | Ga0466712_282692 | 3300042614 | Bacteria | 1718 |
| 130 | Ga0466723_044227 | 3300042618 | Bacteria | 4677 |
| 131 | Ga0466723_079792 | 3300042618 | Bacteria | 2200 |
| 132 | Ga0466726_182054 | 3300042619 | Bacteria | 13107 |
| 133 | Ga0466690_039238 | 3300042590 | Unclassified | 1665 |
| 134 | Ga0466692_046781 | 3300042591 | Bacteria | 4682 |
| 135 | Ga0466691_175646 | 3300042593 | Bacteria | 4110 |
| 136 | Ga0466696_190790 | 3300042596 | Bacteria | 5684 |
| 137 | Ga0466704_185777 | 3300042643 | Bacteria | 11287 |
| 138 | Ga0466704_533934 | 3300042643 | Unclassified | 1586 |
| 139 | Ga0466708_467196 | 3300042652 | Bacteria | 15542 |
| 140 | Ga0466727_161083 | 3300042655 | Bacteria | 1134 |
| 141 | Ga0466727_308455 | 3300042655 | Bacteria | 22441 |
| 142 | Ga0072940_1049412 | 3300005200 | Bacteria | 2627 |
| 143 | Ga0466700_009874 | 3300042600 | Bacteria | 1964 |
| 144 | Ga0466698_180337 | 3300042610 | Bacteria | 2914 |
| 145 | Ga0466712_169748 | 3300042614 | Bacteria | 1149 |
| 146 | Ga0466711_041135 | 3300042615 | Bacteria | 9157 |
| 147 | Ga0466711_176014 | 3300042615 | Bacteria | 31697 |
| 148 | Ga0466715_357043 | 3300042616 | Bacteria | 5307 |
| 149 | Ga0466718_158050 | 3300042617 | Unclassified | 1728 |
| 150 | Ga0466723_057705 | 3300042618 | Bacteria | 15524 |
| 151 | Ga0466728_418452 | 3300042620 | Bacteria | 4940 |
| 152 | Ga0466692_048877 | 3300042591 | Bacteria | 18134 |
| 153 | Ga0466691_050688 | 3300042593 | Bacteria | 2118 |
| 154 | Ga0466735_058388 | 3300042624 | Bacteria | 11868 |
| 155 | Ga0466703_207340 | 3300042636 | Bacteria | 4568 |
| 156 | Ga0466704_217137 | 3300042643 | Bacteria | 1976 |
| 157 | Ga0466709_006307 | 3300042648 | Bacteria | 4194 |
| 158 | Ga0466709_190043 | 3300042648 | Bacteria | 3338 |
| 159 | Ga0072940_1104099 | 3300005200 | Bacteria | 1416 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02653 | BPD_transp_2 | Branched-chain amino acid transport system / permease component | 100 | 351 | 0.89 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.