Protein Family IF03277
Metagenome
Metatranscriptome
Isolate
274
Members
56
Samples
268
Scaffolds
261.31
Avg Length
Representative Sequence
- ID
- 3300010167|Ga0123353_10388585|Ga0123353_103885852
- Length
- 320 aa
- Sequence
- MEKSLFRYSSRGFNESLCGMRTMKREISLTFFSVSKNQIPCYSGLEEPTGFFYQLYQGTVMKFKTKLLVDRFAGIISQWPGVECVSLNEAALPDTLDPYFALIMDIYYRDSIPGPAERHGLFGDDIQVFETSGQGNKDRFLIGNIPVRLEYKSIKMIDELVTIADTKFDSIWFIKDSGTYSFYRLSQGEIIFHRTDWIMDIRKRLTSLGDEFWHLMRHAHESKMEHFLSDLGAAVMQRDDFFYLTSAAGFIKNACLTLFCINRRFEPSHRAYYKQALSLKELPESFPAYLETFLRAEPDLTMERKFSLAQHIARGIVAL*
Sample Types
Isolate
2.2%
Metagenome
97.5%
MAG
0.0%
Metatranscriptome
0.4%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
47.2%
Kalotermitidae
26.4%
Unclassified
13.2%
Termopsidae
7.5%
Rhinotermitidae
5.7%
Taxonomy
Archaea
1
Bacteria
254
Eukaryota
0
Viruses
0
Unclassified
19
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125695 | Treponema sp. Th196P4bin30 | Isolate | Unclassified |
| 2 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 3 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 4 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 5 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 6 | 2781125694 | Treponema sp. Th196P3bin120 | Isolate | Unclassified |
| 7 | 2781125697 | Treponema sp. Th196P4bin17 | Isolate | Unclassified |
| 8 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 9 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 10 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 11 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 12 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 13 | 2781125652 | Treponema sp. Cu122P5bin1 | Isolate | Unclassified |
| 14 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 15 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 16 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 17 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 18 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 19 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 20 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 21 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 22 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 23 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 24 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 25 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 26 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 27 | 2781125656 | Treponema sp. Emb289P1bin65 | Isolate | Unclassified |
| 28 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 29 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 30 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 31 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 32 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 33 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 34 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 35 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 36 | 2819992462 | Unclassified Spirochaetes Nc150P4bin14 | Isolate | Unclassified |
| 37 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 38 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 39 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 40 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 41 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 42 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 43 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 44 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 45 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 46 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 47 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 48 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 49 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 50 | 3300021235 | Termite gut microbial communities from nest from French Guiana - FG16_2_6 mRNA SA | Metatranscriptome | |
| 51 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 52 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 53 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 54 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 55 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 56 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_173029 | 3300042656 | Bacteria | 3024 |
| 2 | Ga0466712_290479 | 3300042614 | Unclassified | 4068 |
| 3 | Ga0466715_230855 | 3300042616 | Bacteria | 4494 |
| 4 | Ga0466715_255824 | 3300042616 | Bacteria | 4323 |
| 5 | Ga0466723_067599 | 3300042618 | Bacteria | 49452 |
| 6 | Ga0466726_112487 | 3300042619 | Bacteria | 24629 |
| 7 | Ga0466726_155564 | 3300042619 | Bacteria | 11238 |
| 8 | Ga0466728_214320 | 3300042620 | Bacteria | 2626 |
| 9 | Ga0466728_354232 | 3300042620 | Bacteria | 4020 |
| 10 | Ga0466716_031596 | 3300042605 | Bacteria | 10825 |
| 11 | Ga0466716_248072 | 3300042605 | Unclassified | 1467 |
| 12 | Ga0466720_055911 | 3300042607 | Bacteria | 20469 |
| 13 | Ga0466720_223034 | 3300042607 | Unclassified | 1110 |
| 14 | Ga0466722_057083 | 3300042609 | Bacteria | 5015 |
| 15 | Ga0466722_268725 | 3300042609 | Bacteria | 7075 |
| 16 | Ga0466731_065591 | 3300042622 | Bacteria | 30138 |
| 17 | Ga0466735_035250 | 3300042624 | Bacteria | 1245 |
| 18 | Ga0466704_340779 | 3300042643 | Bacteria | 29435 |
| 19 | Ga0466709_002685 | 3300042648 | Bacteria | 1928 |
| 20 | Ga0466709_332266 | 3300042648 | Bacteria | 3558 |
| 21 | Ga0466708_020056 | 3300042652 | Bacteria | 11627 |
| 22 | Ga0466690_157045 | 3300042590 | Bacteria | 7964 |
| 23 | Ga0466691_041244 | 3300042593 | Bacteria | 11275 |
| 24 | Ga0466694_246636 | 3300042594 | Bacteria | 1426 |
| 25 | Ga0123355_10145973 | 3300009826 | Archaea | 3607 |
| 26 | AustNasuHG_c1022434 | 3300000089 | Bacteria | 2028 |
| 27 | JGI24702J35022_10007805 | 3300002462 | Bacteria | 6103 |
| 28 | Ga0072940_1019838 | 3300005200 | Bacteria | 1196 |
| 29 | Ga0466705_198481 | 3300042612 | Bacteria | 4433 |
| 30 | Ga0466705_407166 | 3300042612 | Bacteria | 8961 |
| 31 | Ga0466715_040013 | 3300042616 | Bacteria | 12098 |
| 32 | Ga0466715_113224 | 3300042616 | Bacteria | 18533 |
| 33 | Ga0466715_555244 | 3300042616 | Bacteria | 20628 |
| 34 | Ga0466718_133040 | 3300042617 | Bacteria | 17341 |
| 35 | Ga0466723_336774 | 3300042618 | Bacteria | 2384 |
| 36 | Ga0466726_103284 | 3300042619 | Bacteria | 4221 |
| 37 | Ga0466726_147985 | 3300042619 | Bacteria | 1880 |
| 38 | Ga0466728_473550 | 3300042620 | Bacteria | 3435 |
| 39 | Ga0466729_117195 | 3300042621 | Bacteria | 1754 |
| 40 | Ga0466717_266296 | 3300042604 | Unclassified | 1750 |
| 41 | Ga0466716_480194 | 3300042605 | Bacteria | 5027 |
| 42 | Ga0466719_049773 | 3300042606 | Bacteria | 2089 |
| 43 | Ga0466720_083133 | 3300042607 | Bacteria | 11238 |
| 44 | Ga0466722_108537 | 3300042609 | Bacteria | 13976 |
| 45 | Ga0466722_144693 | 3300042609 | Bacteria | 4902 |
| 46 | Ga0466722_156375 | 3300042609 | Bacteria | 4131 |
| 47 | Ga0466722_248170 | 3300042609 | Bacteria | 14435 |
| 48 | Ga0466703_224711 | 3300042636 | Bacteria | 4549 |
| 49 | Ga0466704_197749 | 3300042643 | Bacteria | 1807 |
| 50 | Ga0466708_263468 | 3300042652 | Bacteria | 41501 |
| 51 | Ga0264413_107417 | 3300024493 | Bacteria | 3378 |
| 52 | Ga0264413_127679 | 3300024493 | Bacteria | 8544 |
| 53 | Ga0466690_020063 | 3300042590 | Bacteria | 7276 |
| 54 | Ga0466690_158950 | 3300042590 | Bacteria | 4451 |
| 55 | Ga0466692_119078 | 3300042591 | Bacteria | 6107 |
| 56 | Ga0466693_058481 | 3300042592 | Bacteria | 1113 |
| 57 | Ga0466691_051585 | 3300042593 | Bacteria | 3949 |
| 58 | Ga0466694_123089 | 3300042594 | Bacteria | 1485 |
| 59 | Ga0466694_152937 | 3300042594 | Bacteria | 1390 |
| 60 | Ga0466694_236607 | 3300042594 | Bacteria | 1380 |
| 61 | Ga0466694_321742 | 3300042594 | Unclassified | 2163 |
| 62 | JGI24698J34947_10001222 | 3300002449 | Bacteria | 13432 |
| 63 | JGI24698J34947_10044536 | 3300002449 | Bacteria | 2271 |
| 64 | Ga0068302_10187142 | 3300005071 | Bacteria | 993 |
| 65 | Ga0466733_057677 | 3300042659 | Bacteria | 1272 |
| 66 | Ga0466712_005338 | 3300042614 | Bacteria | 40115 |
| 67 | Ga0466712_038232 | 3300042614 | Bacteria | 9664 |
| 68 | Ga0466712_265690 | 3300042614 | Bacteria | 51797 |
| 69 | Ga0466711_247493 | 3300042615 | Bacteria | 2201 |
| 70 | Ga0466715_316091 | 3300042616 | Bacteria | 7715 |
| 71 | Ga0466715_366293 | 3300042616 | Bacteria | 4163 |
| 72 | Ga0466718_106359 | 3300042617 | Bacteria | 1261 |
| 73 | Ga0466723_009194 | 3300042618 | Bacteria | 10374 |
| 74 | Ga0466700_210065 | 3300042600 | Bacteria | 1747 |
| 75 | Ga0466707_160868 | 3300042601 | Bacteria | 2010 |
| 76 | Ga0466719_477065 | 3300042606 | Bacteria | 1837 |
| 77 | Ga0466722_098641 | 3300042609 | Bacteria | 7268 |
| 78 | Ga0466698_131613 | 3300042610 | Bacteria | 1183 |
| 79 | Ga0466729_268689 | 3300042621 | Bacteria | 3073 |
| 80 | Ga0466704_095899 | 3300042643 | Bacteria | 5515 |
| 81 | Ga0466704_104758 | 3300042643 | Bacteria | 5141 |
| 82 | Ga0466708_304702 | 3300042652 | Bacteria | 4080 |
| 83 | Ga0466691_224657 | 3300042593 | Bacteria | 1627 |
| 84 | Ga0466694_373765 | 3300042594 | Bacteria | 8230 |
| 85 | Ga0123357_10212867 | 3300009784 | Bacteria | 2166 |
| 86 | Ga0123355_10027027 | 3300009826 | Bacteria | 9266 |
| 87 | Ga0123353_10163574 | 3300010167 | Bacteria | 3540 |
| 88 | Ga0123354_10240733 | 3300010882 | Bacteria | 1862 |
| 89 | AustNasuHG_c1000821 | 3300000089 | Bacteria | 11164 |
| 90 | JGI24698J34947_10003810 | 3300002449 | Bacteria | 8215 |
| 91 | JGI24698J34947_10006166 | 3300002449 | Bacteria | 6583 |
| 92 | JGI24695J34938_10001018 | 3300002450 | Bacteria | 25331 |
| 93 | Ga0466705_054568 | 3300042612 | Bacteria | 8142 |
| 94 | Ga0466705_173480 | 3300042612 | Bacteria | 1065 |
| 95 | Ga0466705_266022 | 3300042612 | Bacteria | 4344 |
| 96 | Ga0466732_001894 | 3300042656 | Bacteria | 2372 |
| 97 | Ga0466715_229791 | 3300042616 | Bacteria | 2285 |
| 98 | Ga0466715_274004 | 3300042616 | Bacteria | 12405 |
| 99 | Ga0466715_407483 | 3300042616 | Bacteria | 3440 |
| 100 | Ga0466723_235698 | 3300042618 | Bacteria | 2209 |
| 101 | Ga0466726_151972 | 3300042619 | Bacteria | 3179 |
| 102 | Ga0466726_372392 | 3300042619 | Bacteria | 1111 |
| 103 | Ga0466707_152049 | 3300042601 | Bacteria | 2309 |
| 104 | Ga0466707_153507 | 3300042601 | Bacteria | 1503 |
| 105 | Ga0466720_020049 | 3300042607 | Bacteria | 6276 |
| 106 | Ga0466720_058930 | 3300042607 | Bacteria | 7050 |
| 107 | Ga0466735_078633 | 3300042624 | Bacteria | 1429 |
| 108 | Ga0466735_088095 | 3300042624 | Bacteria | 1360 |
| 109 | Ga0466703_366473 | 3300042636 | Bacteria | 21219 |
| 110 | Ga0466704_005614 | 3300042643 | Unclassified | 4386 |
| 111 | Ga0466704_079747 | 3300042643 | Bacteria | 12802 |
| 112 | Ga0466709_217164 | 3300042648 | Bacteria | 12881 |
| 113 | Ga0466709_261496 | 3300042648 | Bacteria | 4204 |
| 114 | Ga0466708_409942 | 3300042652 | Bacteria | 8109 |
| 115 | Ga0466690_019070 | 3300042590 | Unclassified | 1591 |
| 116 | Ga0466692_027356 | 3300042591 | Bacteria | 11048 |
| 117 | Ga0466692_129340 | 3300042591 | Bacteria | 5526 |
| 118 | Ga0466693_081613 | 3300042592 | Bacteria | 56251 |
| 119 | Ga0466693_437131 | 3300042592 | Bacteria | 2690 |
| 120 | Ga0466696_213837 | 3300042596 | Bacteria | 1277 |
| 121 | Ga0466699_004307 | 3300042597 | Bacteria | 1434 |
| 122 | Ga0466699_142208 | 3300042597 | Bacteria | 3848 |
| 123 | Ga0466699_235367 | 3300042597 | Bacteria | 2120 |
| 124 | Ga0466699_263809 | 3300042597 | Bacteria | 1014 |
| 125 | Ga0123357_10082730 | 3300009784 | Bacteria | 4215 |
| 126 | Ga0123353_10027429 | 3300010167 | Bacteria | 8726 |
| 127 | Ga0123353_10093257 | 3300010167 | Bacteria | 4851 |
| 128 | Ga0123353_10432631 | 3300010167 | Bacteria | 1945 |
| 129 | Ga0123353_10502710 | 3300010167 | Bacteria | 1766 |
| 130 | JGI24698J34947_10001114 | 3300002449 | Bacteria | 13864 |
| 131 | JGI24698J34947_10002521 | 3300002449 | Bacteria | 9884 |
| 132 | JGI24698J34947_10035479 | 3300002449 | Unclassified | 2603 |
| 133 | JGI24695J34938_10110109 | 3300002450 | Bacteria | 1122 |
| 134 | JGI24702J35022_10000901 | 3300002462 | Bacteria | 18491 |
| 135 | Ga0072941_1236842 | 3300005201 | Bacteria | 1155 |
| 136 | Ga0466705_280111 | 3300042612 | Bacteria | 9422 |
| 137 | Ga0466705_424128 | 3300042612 | Bacteria | 3544 |
| 138 | Ga0466712_173531 | 3300042614 | Unclassified | 7071 |
| 139 | Ga0466715_348294 | 3300042616 | Bacteria | 8924 |
| 140 | Ga0466715_442953 | 3300042616 | Bacteria | 5704 |
| 141 | Ga0466723_114352 | 3300042618 | Bacteria | 10350 |
| 142 | Ga0466726_064543 | 3300042619 | Unclassified | 1015 |
| 143 | Ga0466726_366129 | 3300042619 | Bacteria | 4304 |
| 144 | Ga0466728_033206 | 3300042620 | Bacteria | 2756 |
| 145 | Ga0466716_140376 | 3300042605 | Bacteria | 16825 |
| 146 | Ga0466719_064821 | 3300042606 | Bacteria | 2576 |
| 147 | Ga0466719_139834 | 3300042606 | Bacteria | 1902 |
| 148 | Ga0466719_249676 | 3300042606 | Unclassified | 6311 |
| 149 | Ga0466722_027616 | 3300042609 | Bacteria | 3796 |
| 150 | Ga0466722_242626 | 3300042609 | Bacteria | 2116 |
| 151 | Ga0466702_277566 | 3300042635 | Bacteria | 2600 |
| 152 | Ga0466703_057958 | 3300042636 | Bacteria | 3108 |
| 153 | Ga0466704_134285 | 3300042643 | Bacteria | 11586 |
| 154 | Ga0466704_134718 | 3300042643 | Bacteria | 5127 |
| 155 | Ga0466708_003463 | 3300042652 | Bacteria | 22628 |
| 156 | Ga0466708_005781 | 3300042652 | Bacteria | 36777 |
| 157 | Ga0466708_097396 | 3300042652 | Bacteria | 3870 |
| 158 | Ga0415639_090552 | 3300038395 | Bacteria | 9824 |
| 159 | Ga0466692_036810 | 3300042591 | Bacteria | 1843 |
| 160 | Ga0466692_147930 | 3300042591 | Bacteria | 12095 |
| 161 | Ga0466696_054159 | 3300042596 | Bacteria | 1804 |
| 162 | Ga0466696_191510 | 3300042596 | Bacteria | 7513 |
| 163 | Ga0466699_390103 | 3300042597 | Unclassified | 1603 |
| 164 | Ga0123353_10008545 | 3300010167 | Bacteria | 14001 |
| 165 | Ga0123353_10386559 | 3300010167 | Bacteria | 2090 |
| 166 | Ga0123353_10388585 | 3300010167 | Bacteria | 2083 |
| 167 | JGI24698J34947_10000045 | 3300002449 | Bacteria | 35900 |
| 168 | JGI24698J34947_10149290 | 3300002449 | Unclassified | 973 |
| 169 | Ga0072940_1024092 | 3300005200 | Bacteria | 4070 |
| 170 | Ga0072941_1113604 | 3300005201 | Bacteria | 5527 |
| 171 | Ga0466705_173445 | 3300042612 | Bacteria | 1290 |
| 172 | Ga0466705_370117 | 3300042612 | Bacteria | 4063 |
| 173 | Ga0466712_223478 | 3300042614 | Bacteria | 10955 |
| 174 | Ga0466711_191166 | 3300042615 | Unclassified | 2331 |
| 175 | Ga0466715_010887 | 3300042616 | Bacteria | 1822 |
| 176 | Ga0466718_023820 | 3300042617 | Bacteria | 37871 |
| 177 | Ga0466718_159867 | 3300042617 | Bacteria | 2777 |
| 178 | Ga0466723_055933 | 3300042618 | Bacteria | 3562 |
| 179 | Ga0466726_095624 | 3300042619 | Unclassified | 1436 |
| 180 | Ga0466728_098564 | 3300042620 | Bacteria | 2779 |
| 181 | Ga0466728_154373 | 3300042620 | Bacteria | 4879 |
| 182 | Ga0466728_217884 | 3300042620 | Bacteria | 15175 |
| 183 | Ga0466728_302525 | 3300042620 | Unclassified | 1754 |
| 184 | Ga0466719_325650 | 3300042606 | Bacteria | 8302 |
| 185 | Ga0466719_526590 | 3300042606 | Bacteria | 4394 |
| 186 | Ga0466719_550212 | 3300042606 | Bacteria | 5901 |
| 187 | Ga0466722_197968 | 3300042609 | Bacteria | 2367 |
| 188 | Ga0466698_476326 | 3300042610 | Bacteria | 1229 |
| 189 | Ga0466703_070233 | 3300042636 | Bacteria | 12187 |
| 190 | Ga0466704_215626 | 3300042643 | Bacteria | 2425 |
| 191 | Ga0466704_483738 | 3300042643 | Bacteria | 8473 |
| 192 | Ga0466709_139993 | 3300042648 | Bacteria | 7069 |
| 193 | Ga0466709_382506 | 3300042648 | Bacteria | 18808 |
| 194 | Ga0466708_343322 | 3300042652 | Bacteria | 6277 |
| 195 | Ga0466727_013573 | 3300042655 | Bacteria | 26902 |
| 196 | Ga0223674_1001899 | 3300021235 | Bacteria | 1411 |
| 197 | Ga0264413_127416 | 3300024493 | Bacteria | 10936 |
| 198 | Ga0466690_115124 | 3300042590 | Bacteria | 4538 |
| 199 | Ga0466690_241962 | 3300042590 | Bacteria | 2127 |
| 200 | Ga0466690_417299 | 3300042590 | Bacteria | 5759 |
| 201 | Ga0466693_300453 | 3300042592 | Bacteria | 3804 |
| 202 | Ga0466691_127641 | 3300042593 | Bacteria | 3617 |
| 203 | Ga0466691_132763 | 3300042593 | Bacteria | 7592 |
| 204 | Ga0123357_10022271 | 3300009784 | Bacteria | 8490 |
| 205 | Ga0123353_10307563 | 3300010167 | Bacteria | 2415 |
| 206 | Ga0123353_10564852 | 3300010167 | Bacteria | 1637 |
| 207 | JGI24698J34947_10120562 | 3300002449 | Bacteria | 1139 |
| 208 | Ga0466732_158878 | 3300042656 | Bacteria | 3193 |
| 209 | Ga0466712_008527 | 3300042614 | Bacteria | 5153 |
| 210 | Ga0466712_124226 | 3300042614 | Bacteria | 1182 |
| 211 | Ga0466712_143501 | 3300042614 | Bacteria | 35439 |
| 212 | Ga0466711_228845 | 3300042615 | Bacteria | 2458 |
| 213 | Ga0466715_072653 | 3300042616 | Bacteria | 9131 |
| 214 | Ga0466715_085939 | 3300042616 | Bacteria | 16172 |
| 215 | Ga0466715_394272 | 3300042616 | Bacteria | 3035 |
| 216 | Ga0466728_096051 | 3300042620 | Bacteria | 5084 |
| 217 | Ga0466728_208594 | 3300042620 | Bacteria | 5072 |
| 218 | Ga0466707_291219 | 3300042601 | Bacteria | 1311 |
| 219 | Ga0466716_372249 | 3300042605 | Bacteria | 2548 |
| 220 | Ga0466722_005029 | 3300042609 | Bacteria | 14605 |
| 221 | Ga0466722_034290 | 3300042609 | Bacteria | 2418 |
| 222 | Ga0466722_228368 | 3300042609 | Bacteria | 8229 |
| 223 | Ga0466709_238901 | 3300042648 | Bacteria | 3272 |
| 224 | Ga0466708_152078 | 3300042652 | Bacteria | 8762 |
| 225 | Ga0264413_101596 | 3300024493 | Bacteria | 10290 |
| 226 | Ga0466690_050910 | 3300042590 | Bacteria | 8363 |
| 227 | Ga0466690_085956 | 3300042590 | Bacteria | 15265 |
| 228 | Ga0466699_185477 | 3300042597 | Bacteria | 1723 |
| 229 | Ga0466699_244755 | 3300042597 | Bacteria | 1389 |
| 230 | Ga0466699_258945 | 3300042597 | Bacteria | 2554 |
| 231 | Ga0466699_425853 | 3300042597 | Bacteria | 1755 |
| 232 | Ga0123356_10256762 | 3300010049 | Bacteria | 1829 |
| 233 | Ga0123353_10058541 | 3300010167 | Bacteria | 6174 |
| 234 | Ga0123353_10548514 | 3300010167 | Bacteria | 1668 |
| 235 | JGI24698J34947_10049803 | 3300002449 | Bacteria | 2115 |
| 236 | JGI24697J35500_11274691 | 3300002507 | Bacteria | 8760 |
| 237 | Ga0466705_218999 | 3300042612 | Bacteria | 36957 |
| 238 | Ga0466705_454128 | 3300042612 | Bacteria | 3605 |
| 239 | Ga0466711_210239 | 3300042615 | Bacteria | 1800 |
| 240 | Ga0466715_439607 | 3300042616 | Bacteria | 1426 |
| 241 | Ga0466715_493755 | 3300042616 | Bacteria | 6283 |
| 242 | Ga0466723_078129 | 3300042618 | Bacteria | 9099 |
| 243 | Ga0466723_195168 | 3300042618 | Bacteria | 7426 |
| 244 | Ga0466726_105173 | 3300042619 | Bacteria | 6523 |
| 245 | Ga0466726_494885 | 3300042619 | Bacteria | 1557 |
| 246 | Ga0466707_217796 | 3300042601 | Bacteria | 10642 |
| 247 | Ga0466716_087129 | 3300042605 | Bacteria | 3622 |
| 248 | Ga0466716_156210 | 3300042605 | Bacteria | 16631 |
| 249 | Ga0466716_457246 | 3300042605 | Unclassified | 2537 |
| 250 | Ga0466722_145937 | 3300042609 | Bacteria | 2801 |
| 251 | Ga0466722_165476 | 3300042609 | Bacteria | 9784 |
| 252 | Ga0466703_006434 | 3300042636 | Bacteria | 5718 |
| 253 | Ga0466703_009093 | 3300042636 | Unclassified | 1492 |
| 254 | Ga0466704_585141 | 3300042643 | Bacteria | 4455 |
| 255 | Ga0466708_021789 | 3300042652 | Bacteria | 5558 |
| 256 | Ga0466708_075870 | 3300042652 | Bacteria | 4473 |
| 257 | Ga0466708_100085 | 3300042652 | Unclassified | 4179 |
| 258 | Ga0466708_140368 | 3300042652 | Bacteria | 1197 |
| 259 | Ga0466708_343561 | 3300042652 | Bacteria | 5724 |
| 260 | Ga0466727_054471 | 3300042655 | Bacteria | 6302 |
| 261 | Ga0415639_032107 | 3300038395 | Bacteria | 9181 |
| 262 | Ga0466694_231128 | 3300042594 | Bacteria | 2499 |
| 263 | Ga0123356_10004614 | 3300010049 | Bacteria | 14190 |
| 264 | Ga0123356_10085619 | 3300010049 | Bacteria | 2990 |
| 265 | Ga0123356_10321015 | 3300010049 | Bacteria | 1662 |
| 266 | Ga0123353_10236785 | 3300010167 | Bacteria | 2841 |
| 267 | JGI24698J34947_10116017 | 3300002449 | Bacteria | 1172 |
| 268 | JGI24702J35022_10001630 | 3300002462 | Bacteria | 13908 |
MSA Aligner
Geographic Distribution
Some samples may be missing due to lack of coordinate data.