Protein Family IF03175

Metagenome Isolate
122 Members
34 Samples
114 Scaffolds
213.7 Avg Length

🧬 Representative Sequence

ID
3300010167|Ga0123353_10168341|Ga0123353_101683413
Length
237 aa
Sequence
LKFILKILPRRDKLELPDTKSGGKIMAGTTELPREKLNKKGASALTDVELLQAVIGSGGKDNDFRQIAKNLYTSIQKIGAENLTIDDVKAVKGIGDAKATTVFAALEFWRRRFTKQSAPLIDSPERAAEQMSFIKNKKQEYFVMLTLDGARRLINCRTITIGTLMSSLVHPREVFSPAIEDRAASIIIGHNHPSGMLDISEQDKDVIKRIRLAGELLGIRLDDHIIVAGDEFVSAY*

📊 Sample Types

Isolate 6.6%
Metagenome 93.4%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 51.5%
Unclassified 24.2%
Kalotermitidae 21.2%
Rhinotermitidae 3.0%

🌳 Taxonomy

Archaea 0
Bacteria 110
Eukaryota 0
Viruses 0
Unclassified 12

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820282995 Unclassified Firmicutes Th196P3bin147 Isolate Unclassified
2 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
3 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
4 2820620956 Unclassified Firmicutes Emb289P1bin128 Isolate Unclassified
5 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
6 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
7 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
8 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
9 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
10 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
11 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
12 2820637417 Unclassified Firmicutes Emb289P1bin108 Isolate Unclassified
13 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
14 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
15 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
16 2820242869 Unclassified Firmicutes Th196P3bin82 Isolate Unclassified
17 2820683647 Unclassified Firmicutes Co191P1bin82 Isolate Unclassified
18 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
19 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
20 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
21 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
22 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
23 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
24 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
25 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
26 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
27 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
28 2820231849 Unclassified Firmicutes Th196P4bin1 Isolate Unclassified
29 2820369699 Unclassified Firmicutes Nt197P3bin103 Isolate Unclassified
30 2820427814 Unclassified Firmicutes Lab288P3bin44 Isolate Unclassified
31 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
32 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
33 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
34 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_139792 3300042659 Bacteria 1753
2 Ga0466718_167802 3300042617 Bacteria 2388
3 Ga0466719_411563 3300042606 Bacteria 3737
4 Ga0466719_462881 3300042606 Bacteria 2467
5 Ga0123356_10049451 3300010049 Bacteria 3914
6 Ga0123356_10051306 3300010049 Bacteria 3838
7 Ga0123356_10111427 3300010049 Bacteria 2644
8 Ga0123356_10128629 3300010049 Bacteria 2477
9 Ga0123353_10009772 3300010167 Bacteria 13290
10 Ga0123353_10087584 3300010167 Bacteria 5016
11 Ga0123353_10156830 3300010167 Bacteria 3627
12 Ga0123353_10243137 3300010167 Bacteria 2794
13 Ga0123353_10397137 3300010167 Bacteria 2054
14 Ga0123353_11235069 3300010167 Bacteria 977
15 Ga0123353_11575389 3300010167 Bacteria 831
16 Ga0466657_173415 3300042582 Bacteria 1744
17 Ga0466691_084399 3300042593 Bacteria 15585
18 JGI24695J34938_10013298 3300002450 Bacteria 4329
19 JGI24702J35022_10085116 3300002462 Bacteria 1717
20 Ga0466729_065976 3300042621 Bacteria 3657
21 Ga0123356_10000759 3300010049 Bacteria 35678
22 Ga0123353_10024860 3300010167 Unclassified 9108
23 Ga0123353_10138983 3300010167 Bacteria 3894
24 Ga0415639_026710 3300038395 Bacteria 3821
25 Ga0466691_019677 3300042593 Unclassified 4179
26 JGI24695J34938_10016301 3300002450 Bacteria 3783
27 Ga0466719_326900 3300042606 Bacteria 6370
28 Ga0123355_10028539 3300009826 Bacteria 9024
29 Ga0123355_10114257 3300009826 Bacteria 4209
30 Ga0123353_10163550 3300010167 Bacteria 3540
31 Ga0123353_10176663 3300010167 Bacteria 3385
32 Ga0123353_10299739 3300010167 Bacteria 2454
33 Ga0123353_10404122 3300010167 Unclassified 2031
34 Ga0123353_10453541 3300010167 Bacteria 1887
35 Ga0466691_092936 3300042593 Bacteria 11644
36 JGI24702J35022_10556692 3300002462 Bacteria 707
37 Ga0466725_243883 3300042654 Unclassified 5371
38 Ga0466719_254935 3300042606 Bacteria 7119
39 Ga0123355_10000614 3300009826 Bacteria 48126
40 Ga0123356_10065920 3300010049 Bacteria 3389
41 Ga0123356_10234673 3300010049 Bacteria 1901
42 Ga0123356_10736998 3300010049 Bacteria 1155
43 Ga0123353_10078276 3300010167 Bacteria 5314
44 Ga0123353_10090331 3300010167 Bacteria 4932
45 Ga0123353_10121866 3300010167 Bacteria 4192
46 Ga0123353_10455755 3300010167 Bacteria 1881
47 Ga0123353_10496472 3300010167 Bacteria 1780
48 Ga0123353_10595700 3300010167 Bacteria 1581
49 Ga0123353_10627357 3300010167 Unclassified 1528
50 Ga0072941_1086378 3300005201 Bacteria 3985
51 Ga0466705_299029 3300042612 Bacteria 6489
52 Ga0466715_502478 3300042616 Bacteria 13014
53 Ga0123357_10159978 3300009784 Bacteria 2703
54 Ga0123356_10000740 3300010049 Bacteria 36026
55 Ga0123356_10122277 3300010049 Bacteria 2535
56 Ga0123356_10518755 3300010049 Bacteria 1350
57 Ga0123356_11498344 3300010049 Bacteria 832
58 Ga0123353_10211376 3300010167 Bacteria 3043
59 Ga0123353_10305332 3300010167 Bacteria 2426
60 Ga0123353_10850237 3300010167 Unclassified 1251
61 Ga0123353_11193978 3300010167 Bacteria 999
62 Ga0123353_12177918 3300010167 Bacteria 672
63 Ga0123354_10255646 3300010882 Bacteria 1763
64 Ga0123354_10318747 3300010882 Bacteria 1438
65 Ga0123354_10546328 3300010882 Bacteria 876
66 Ga0466697_190193 3300042611 Bacteria 2047
67 Ga0466711_195398 3300042615 Bacteria 14325
68 Ga0466711_389390 3300042615 Bacteria 4466
69 Ga0466697_049634 3300042611 Bacteria 1548
70 Ga0123355_10003358 3300009826 Bacteria 22912
71 Ga0123356_10021558 3300010049 Bacteria 6080
72 Ga0123356_10026022 3300010049 Bacteria 5500
73 Ga0123356_10060717 3300010049 Bacteria 3528
74 Ga0123356_10114266 3300010049 Unclassified 2614
75 Ga0123356_10366699 3300010049 Bacteria 1569
76 Ga0123356_10764610 3300010049 Bacteria 1137
77 Ga0123356_11445895 3300010049 Bacteria 847
78 Ga0123353_10149346 3300010167 Bacteria 3732
79 Ga0123353_10301550 3300010167 Unclassified 2445
80 Ga0123353_10326531 3300010167 Bacteria 2325
81 Ga0123353_10530966 3300010167 Bacteria 1704
82 JGI24702J35022_10006269 3300002462 Bacteria 6883
83 Ga0072940_1380746 3300005200 Unclassified 756
84 Ga0466705_037564 3300042612 Bacteria 4514
85 Ga0466715_183033 3300042616 Bacteria 49374
86 Ga0466717_281608 3300042604 Bacteria 10910
87 Ga0466719_062544 3300042606 Bacteria 12526
88 Ga0466697_012873 3300042611 Bacteria 4073
89 Ga0123355_10205224 3300009826 Unclassified 2869
90 Ga0123356_10007969 3300010049 Bacteria 10543
91 Ga0123356_10017382 3300010049 Bacteria 6841
92 Ga0123356_10065042 3300010049 Bacteria 3411
93 Ga0123353_11428238 3300010167 Bacteria 887
94 Ga0123353_11852014 3300010167 Bacteria 747
95 Ga0123354_10140944 3300010882 Bacteria 2983
96 Ga0123354_10176178 3300010882 Bacteria 2464
97 JGI24705J35276_12177640 3300002504 Bacteria 1341
98 Ga0466697_097148 3300042611 Bacteria 1472
99 Ga0466723_111628 3300042618 Bacteria 25050
100 Ga0466701_065657 3300042598 Bacteria 1093
101 Ga0466717_064223 3300042604 Bacteria 5301
102 Ga0466719_538055 3300042606 Bacteria 1907
103 Ga0123355_10001870 3300009826 Unclassified 29520
104 Ga0123356_10044695 3300010049 Bacteria 4123
105 Ga0123356_10272485 3300010049 Bacteria 1783
106 Ga0123356_10766661 3300010049 Bacteria 1135
107 Ga0123353_10007034 3300010167 Bacteria 15131
108 Ga0123353_10053008 3300010167 Bacteria 6483
109 Ga0123353_10168341 3300010167 Bacteria 3481
110 Ga0123353_10558440 3300010167 Bacteria 1649
111 Ga0123353_11867364 3300010167 Bacteria 743
112 Ga0123354_10134609 3300010882 Unclassified 3099
113 Ga0466690_210457 3300042590 Bacteria 2987
114 Ga0072940_1458755 3300005200 Bacteria 769

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF04002 RadC RadC-like JAB domain 121 234 0.96
PF20582 UPF0758_N UPF0758 N-terminal 30 99 0.9

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.