Protein Family IF03118
Metagenome
Isolate
130
Members
45
Samples
128
Scaffolds
221.65
Avg Length
Representative Sequence
- ID
- 3300010167|Ga0123353_10083234|Ga0123353_100832345
- Length
- 248 aa
- Sequence
- MRPKFATKLNEEKGIEKCFYHQITINKMNLLIDQISESVEYGKVNLVSPYPPQMKGRLGADELTRQALDEGITPADILNLALVPAMNNVGQKYAENKIFVPQMLLSAKAMSASMSHLKPYFQSGEIKRKGVMIMGTVMGDLHDIGKNLCCMMVEGAGWEVVDLGVDVKPEKFIAALDSNPNAIIALSALLTTTMVNMKTIITAIRQKYPNTKVAVGGAPVNNDFAVSIGANGYGKDPQELITWLDKA*
Sample Types
Isolate
1.5%
Metagenome
98.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
50.0%
Kalotermitidae
22.7%
Termopsidae
9.1%
Rhinotermitidae
6.8%
Blattidae
4.5%
Unclassified
4.5%
Passalidae
2.3%
Taxonomy
Archaea
1
Bacteria
115
Eukaryota
0
Viruses
0
Unclassified
14
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 2 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 3 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 4 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 5 | 2910949487 | Dysgonomonas sp. 520 | Isolate | Blattidae |
| 6 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 7 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 8 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 9 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 10 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 11 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 12 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 13 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 14 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 15 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 16 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 17 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 18 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 19 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 20 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 21 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 22 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 23 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 24 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 25 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 26 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 27 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 28 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 29 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 30 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 31 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 32 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 33 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 34 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 35 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 36 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 37 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 38 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 39 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 40 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 41 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 42 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 43 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 44 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 45 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466700_342782 | 3300042600 | Bacteria | 3029 |
| 2 | Ga0466707_356482 | 3300042601 | Bacteria | 19302 |
| 3 | JGI24702J35022_10002541 | 3300002462 | Unclassified | 11097 |
| 4 | JGI24702J35022_10139881 | 3300002462 | Bacteria | 1350 |
| 5 | Ga0466657_287728 | 3300042582 | Unclassified | 1000 |
| 6 | Ga0466694_256880 | 3300042594 | Bacteria | 5103 |
| 7 | Ga0466696_379219 | 3300042596 | Bacteria | 1389 |
| 8 | Ga0466711_112305 | 3300042615 | Bacteria | 57527 |
| 9 | Ga0466715_204999 | 3300042616 | Bacteria | 60693 |
| 10 | Ga0466718_050239 | 3300042617 | Bacteria | 1705 |
| 11 | Ga0123356_10800819 | 3300010049 | Bacteria | 1113 |
| 12 | Ga0123353_10499208 | 3300010167 | Bacteria | 1774 |
| 13 | Ga0123353_11295475 | 3300010167 | Bacteria | 947 |
| 14 | Ga0123354_10399839 | 3300010882 | Bacteria | 1164 |
| 15 | Ga0466735_074699 | 3300042624 | Bacteria | 3221 |
| 16 | Ga0466735_114030 | 3300042624 | Bacteria | 1468 |
| 17 | Ga0466704_032141 | 3300042643 | Bacteria | 8185 |
| 18 | Ga0466727_236230 | 3300042655 | Bacteria | 3971 |
| 19 | Ga0466701_072055 | 3300042598 | Bacteria | 39896 |
| 20 | Ga0466700_037263 | 3300042600 | Bacteria | 3533 |
| 21 | Ga0466707_356884 | 3300042601 | Unclassified | 1116 |
| 22 | Ga0466713_098398 | 3300042602 | Bacteria | 4409 |
| 23 | Ga0466713_122021 | 3300042602 | Bacteria | 7861 |
| 24 | Ga0466717_162640 | 3300042604 | Unclassified | 1213 |
| 25 | JGI24702J35022_10222002 | 3300002462 | Bacteria | 1089 |
| 26 | JGI24705J35276_12238079 | 3300002504 | Bacteria | 15649 |
| 27 | Ga0068302_10120000 | 3300005071 | Bacteria | 2050 |
| 28 | Ga0466711_013510 | 3300042615 | Bacteria | 62233 |
| 29 | Ga0466715_346237 | 3300042616 | Bacteria | 19453 |
| 30 | Ga0466726_224014 | 3300042619 | Bacteria | 21151 |
| 31 | Ga0123353_10026468 | 3300010167 | Bacteria | 8860 |
| 32 | Ga0123353_10083234 | 3300010167 | Bacteria | 5148 |
| 33 | Ga0123354_10145166 | 3300010882 | Bacteria | 2909 |
| 34 | Ga0466735_025126 | 3300042624 | Bacteria | 7991 |
| 35 | Ga0466735_102276 | 3300042624 | Unclassified | 1097 |
| 36 | Ga0466735_219205 | 3300042624 | Unclassified | 1809 |
| 37 | Ga0466725_459992 | 3300042654 | Bacteria | 11425 |
| 38 | Ga0466717_267582 | 3300042604 | Bacteria | 6669 |
| 39 | JGI24698J34947_10056799 | 3300002449 | Bacteria | 1944 |
| 40 | JGI24705J35276_12218935 | 3300002504 | Unclassified | 2174 |
| 41 | Ga0466690_100077 | 3300042590 | Bacteria | 8481 |
| 42 | Ga0466694_195749 | 3300042594 | Bacteria | 1220 |
| 43 | Ga0466715_243245 | 3300042616 | Bacteria | 41313 |
| 44 | Ga0466726_303330 | 3300042619 | Bacteria | 4183 |
| 45 | Ga0123356_10051989 | 3300010049 | Bacteria | 3811 |
| 46 | Ga0123356_10061275 | 3300010049 | Bacteria | 3513 |
| 47 | Ga0123353_10830205 | 3300010167 | Bacteria | 1271 |
| 48 | Ga0466703_006198 | 3300042636 | Bacteria | 5722 |
| 49 | Ga0466704_235272 | 3300042643 | Bacteria | 18651 |
| 50 | Ga0466713_026427 | 3300042602 | Bacteria | 21271 |
| 51 | Ga0466713_032406 | 3300042602 | Bacteria | 15683 |
| 52 | Ga0466716_099540 | 3300042605 | Bacteria | 60236 |
| 53 | Ga0466722_060983 | 3300042609 | Bacteria | 4768 |
| 54 | Ga0466698_097590 | 3300042610 | Bacteria | 3149 |
| 55 | JGI24702J35022_10006653 | 3300002462 | Bacteria | 6670 |
| 56 | JGI24705J35276_12209798 | 3300002504 | Archaea | 1807 |
| 57 | Ga0123357_10000997 | 3300009784 | Bacteria | 28966 |
| 58 | Ga0466693_407638 | 3300042592 | Unclassified | 2237 |
| 59 | Ga0466729_014225 | 3300042621 | Bacteria | 5615 |
| 60 | Ga0123356_10333651 | 3300010049 | Bacteria | 1634 |
| 61 | Ga0123353_10442625 | 3300010167 | Unclassified | 1916 |
| 62 | Ga0123354_10004047 | 3300010882 | Bacteria | 20583 |
| 63 | Ga0466734_015555 | 3300042623 | Bacteria | 1410 |
| 64 | Ga0466707_083286 | 3300042601 | Bacteria | 4613 |
| 65 | Ga0466722_059483 | 3300042609 | Bacteria | 7591 |
| 66 | JGI24702J35022_10026177 | 3300002462 | Bacteria | 3143 |
| 67 | Ga0072941_1321778 | 3300005201 | Bacteria | 1641 |
| 68 | Ga0466656_262939 | 3300042550 | Unclassified | 1739 |
| 69 | Ga0466692_094334 | 3300042591 | Bacteria | 22451 |
| 70 | Ga0466710_035038 | 3300042613 | Bacteria | 1481 |
| 71 | Ga0466711_280052 | 3300042615 | Bacteria | 19914 |
| 72 | Ga0123356_10383423 | 3300010049 | Bacteria | 1539 |
| 73 | Ga0123353_10628556 | 3300010167 | Bacteria | 1526 |
| 74 | Ga0466735_002821 | 3300042624 | Bacteria | 5985 |
| 75 | Ga0466697_109709 | 3300042611 | Bacteria | 1556 |
| 76 | Ga0466733_149379 | 3300042659 | Bacteria | 5536 |
| 77 | Ga0466707_313057 | 3300042601 | Bacteria | 2262 |
| 78 | Ga0466717_292391 | 3300042604 | Bacteria | 2566 |
| 79 | Ga0466697_049731 | 3300042611 | Bacteria | 3724 |
| 80 | 2227563537 | 2225789004 | Bacteria | 14275 |
| 81 | JGI24702J35022_10028080 | 3300002462 | Bacteria | 3026 |
| 82 | JGI24705J35276_12225312 | 3300002504 | Bacteria | 2706 |
| 83 | JGI24705J35276_12234937 | 3300002504 | Bacteria | 6005 |
| 84 | Ga0072941_1223344 | 3300005201 | Bacteria | 3445 |
| 85 | Ga0466693_406604 | 3300042592 | Bacteria | 2459 |
| 86 | Ga0466723_103758 | 3300042618 | Bacteria | 16804 |
| 87 | Ga0466728_005842 | 3300042620 | Bacteria | 12269 |
| 88 | Ga0123357_10124443 | 3300009784 | Unclassified | 3235 |
| 89 | Ga0123356_10251720 | 3300010049 | Bacteria | 1844 |
| 90 | Ga0123356_10469359 | 3300010049 | Bacteria | 1410 |
| 91 | Ga0123353_10396492 | 3300010167 | Bacteria | 2056 |
| 92 | Ga0123353_10473506 | 3300010167 | Bacteria | 1835 |
| 93 | Ga0123354_10089178 | 3300010882 | Bacteria | 4282 |
| 94 | Ga0123354_10166068 | 3300010882 | Unclassified | 2594 |
| 95 | Ga0123354_10191110 | 3300010882 | Bacteria | 2292 |
| 96 | Ga0466735_007170 | 3300042624 | Bacteria | 7012 |
| 97 | Ga0466735_148779 | 3300042624 | Bacteria | 1534 |
| 98 | Ga0466727_024447 | 3300042655 | Bacteria | 8491 |
| 99 | Ga0466727_291441 | 3300042655 | Bacteria | 55290 |
| 100 | Ga0466733_097262 | 3300042659 | Bacteria | 3501 |
| 101 | Ga0466733_121185 | 3300042659 | Bacteria | 15844 |
| 102 | Ga0466707_059885 | 3300042601 | Bacteria | 4807 |
| 103 | Ga0466722_020943 | 3300042609 | Bacteria | 1813 |
| 104 | JGI24702J35022_10000344 | 3300002462 | Bacteria | 27507 |
| 105 | JGI24702J35022_10159727 | 3300002462 | Bacteria | 1269 |
| 106 | Ga0466690_139039 | 3300042590 | Bacteria | 12228 |
| 107 | Ga0466715_120085 | 3300042616 | Bacteria | 61118 |
| 108 | Ga0466723_095423 | 3300042618 | Bacteria | 9153 |
| 109 | Ga0123356_11833944 | 3300010049 | Unclassified | 754 |
| 110 | Ga0123353_10271028 | 3300010167 | Bacteria | 2615 |
| 111 | Ga0123353_10466199 | 3300010167 | Bacteria | 1854 |
| 112 | Ga0466703_389385 | 3300042636 | Bacteria | 31539 |
| 113 | Ga0466705_279959 | 3300042612 | Bacteria | 5632 |
| 114 | Ga0466713_029889 | 3300042602 | Bacteria | 53582 |
| 115 | Ga0466713_033462 | 3300042602 | Bacteria | 7286 |
| 116 | Ga0466713_051563 | 3300042602 | Bacteria | 1098 |
| 117 | Ga0466713_141633 | 3300042602 | Bacteria | 2046 |
| 118 | JGI24702J35022_10154465 | 3300002462 | Bacteria | 1289 |
| 119 | JGI24696J40584_12954678 | 3300002834 | Bacteria | 2683 |
| 120 | Ga0466692_003015 | 3300042591 | Bacteria | 5124 |
| 121 | Ga0466729_024558 | 3300042621 | Bacteria | 9835 |
| 122 | Ga0123357_10033208 | 3300009784 | Bacteria | 7011 |
| 123 | Ga0123356_10723426 | 3300010049 | Bacteria | 1165 |
| 124 | Ga0123353_10029572 | 3300010167 | Bacteria | 8448 |
| 125 | Ga0123353_10303428 | 3300010167 | Bacteria | 2435 |
| 126 | Ga0123354_10071292 | 3300010882 | Bacteria | 5017 |
| 127 | Ga0466735_130976 | 3300042624 | Bacteria | 4605 |
| 128 | Ga0466735_233492 | 3300042624 | Unclassified | 1322 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.