Protein Family IF02945
Metagenome
Isolate
124
Members
29
Samples
116
Scaffolds
185.52
Avg Length
Representative Sequence
- ID
- 3300010049|Ga0123356_10712699|Ga0123356_107126991
- Length
- 223 aa
- Sequence
- LKQIILVCTVKGNNGKLYADDIKSIEKHKYIKRRGICVVDIIEAQEILKKYNTEPFHIKHAETVSGVLRHFAGEFDPGREEYWAVVGLLHDIDFELYPDEHCVKGEELFRAEGVGEDIIRSALSHGWGMTGSKHEPVHIMEKILFACDELTGLIWAATLMRPSKSTQDLEVSSVKKKFKDKKFAAGCSRDVVKQGAEMLGWELDELFERTIMAMRAIEQITQ*
Sample Types
Isolate
6.5%
Metagenome
93.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
44.8%
Unclassified
37.9%
Kalotermitidae
6.9%
Termopsidae
6.9%
Rhinotermitidae
3.4%
Taxonomy
Archaea
0
Bacteria
122
Eukaryota
0
Viruses
0
Unclassified
2
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 2 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 3 | 2820533259 | Unclassified Firmicutes Lab288P1bin140 | Isolate | Unclassified |
| 4 | 2820594669 | Unclassified Firmicutes Emb289P1bin61 | Isolate | Unclassified |
| 5 | 2820623020 | Unclassified Firmicutes Emb289P1bin126 | Isolate | Unclassified |
| 6 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 7 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 8 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 9 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 10 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 11 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 12 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 13 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 14 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 15 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 16 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 17 | 2820661146 | Unclassified Firmicutes Co191P3bin61 | Isolate | Unclassified |
| 18 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 19 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 20 | 2820234266 | Unclassified Firmicutes Th196P3bin99 | Isolate | Unclassified |
| 21 | 2820408893 | Unclassified Firmicutes Lab288P4bin80 | Isolate | Unclassified |
| 22 | 2820690275 | Unclassified Firmicutes Co191P1bin72 | Isolate | Unclassified |
| 23 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 24 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 25 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 26 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 27 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 28 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 29 | 2820637417 | Unclassified Firmicutes Emb289P1bin108 | Isolate | Unclassified |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466694_275962 | 3300042594 | Bacteria | 1667 |
| 2 | Ga0123355_10008998 | 3300009826 | Bacteria | 15134 |
| 3 | Ga0123355_10020287 | 3300009826 | Bacteria | 10608 |
| 4 | Ga0123355_10043972 | 3300009826 | Bacteria | 7267 |
| 5 | Ga0123356_10005681 | 3300010049 | Bacteria | 12666 |
| 6 | Ga0123356_10012763 | 3300010049 | Bacteria | 8135 |
| 7 | Ga0123356_10172790 | 3300010049 | Bacteria | 2173 |
| 8 | Ga0123356_10243823 | 3300010049 | Bacteria | 1870 |
| 9 | Ga0123356_10969727 | 3300010049 | Bacteria | 1021 |
| 10 | Ga0123353_10081642 | 3300010167 | Bacteria | 5199 |
| 11 | Ga0123353_10477090 | 3300010167 | Unclassified | 1826 |
| 12 | Ga0123353_10636076 | 3300010167 | Bacteria | 1514 |
| 13 | Ga0123354_10144013 | 3300010882 | Bacteria | 2929 |
| 14 | Ga0466707_037974 | 3300042601 | Bacteria | 12840 |
| 15 | Ga0466713_064276 | 3300042602 | Bacteria | 38268 |
| 16 | Ga0466693_176876 | 3300042592 | Bacteria | 1737 |
| 17 | Ga0123355_10010183 | 3300009826 | Bacteria | 14375 |
| 18 | Ga0123355_10685989 | 3300009826 | Bacteria | 1182 |
| 19 | Ga0123356_10031407 | 3300010049 | Bacteria | 4970 |
| 20 | Ga0123356_10088668 | 3300010049 | Bacteria | 2941 |
| 21 | Ga0123356_10273146 | 3300010049 | Bacteria | 1781 |
| 22 | Ga0123356_12134200 | 3300010049 | Bacteria | 700 |
| 23 | Ga0123353_10009724 | 3300010167 | Bacteria | 13317 |
| 24 | Ga0123353_10172202 | 3300010167 | Bacteria | 3435 |
| 25 | Ga0123353_10255702 | 3300010167 | Bacteria | 2709 |
| 26 | Ga0123353_10280251 | 3300010167 | Bacteria | 2561 |
| 27 | Ga0123353_11087006 | 3300010167 | Bacteria | 1063 |
| 28 | Ga0123354_10037285 | 3300010882 | Bacteria | 7567 |
| 29 | Ga0068305_10003993 | 3300005083 | Bacteria | 109457 |
| 30 | Ga0466713_034858 | 3300042602 | Bacteria | 20190 |
| 31 | Ga0466721_066480 | 3300042608 | Bacteria | 2413 |
| 32 | Ga0123355_10006752 | 3300009826 | Bacteria | 17080 |
| 33 | Ga0123355_10054027 | 3300009826 | Bacteria | 6510 |
| 34 | Ga0123355_10183763 | 3300009826 | Bacteria | 3097 |
| 35 | Ga0123356_10001928 | 3300010049 | Bacteria | 22453 |
| 36 | Ga0123356_10003277 | 3300010049 | Bacteria | 17007 |
| 37 | Ga0123356_10071003 | 3300010049 | Bacteria | 3268 |
| 38 | Ga0123356_10253545 | 3300010049 | Bacteria | 1839 |
| 39 | Ga0123356_11263275 | 3300010049 | Bacteria | 903 |
| 40 | Ga0123353_10086228 | 3300010167 | Bacteria | 5056 |
| 41 | Ga0123353_10951316 | 3300010167 | Bacteria | 1162 |
| 42 | Ga0123355_11018841 | 3300009826 | Bacteria | 876 |
| 43 | Ga0123356_10314153 | 3300010049 | Bacteria | 1677 |
| 44 | Ga0123356_10581268 | 3300010049 | Bacteria | 1283 |
| 45 | Ga0123356_12565461 | 3300010049 | Bacteria | 638 |
| 46 | Ga0123353_10023033 | 3300010167 | Bacteria | 9416 |
| 47 | Ga0123353_10685241 | 3300010167 | Bacteria | 1442 |
| 48 | Ga0123353_11070645 | 3300010167 | Bacteria | 1074 |
| 49 | Ga0123353_11607540 | 3300010167 | Bacteria | 820 |
| 50 | Ga0466735_114004 | 3300042624 | Bacteria | 1303 |
| 51 | Ga0466704_606967 | 3300042643 | Bacteria | 2516 |
| 52 | JGI24702J35022_10046089 | 3300002462 | Bacteria | 2322 |
| 53 | Ga0466705_141234 | 3300042612 | Bacteria | 1072 |
| 54 | Ga0415639_103365 | 3300038395 | Bacteria | 2287 |
| 55 | Ga0123355_10188645 | 3300009826 | Bacteria | 3042 |
| 56 | Ga0123356_10088865 | 3300010049 | Bacteria | 2939 |
| 57 | Ga0123356_10093857 | 3300010049 | Bacteria | 2864 |
| 58 | Ga0123356_10279560 | 3300010049 | Bacteria | 1763 |
| 59 | Ga0123356_10299300 | 3300010049 | Bacteria | 1713 |
| 60 | Ga0123356_10414431 | 3300010049 | Bacteria | 1488 |
| 61 | Ga0123356_10510682 | 3300010049 | Bacteria | 1359 |
| 62 | Ga0123356_10712699 | 3300010049 | Bacteria | 1173 |
| 63 | Ga0123353_10257866 | 3300010167 | Bacteria | 2696 |
| 64 | Ga0123353_10317787 | 3300010167 | Bacteria | 2365 |
| 65 | JGI24702J35022_10123019 | 3300002462 | Bacteria | 1434 |
| 66 | Ga0466722_125173 | 3300042609 | Bacteria | 14932 |
| 67 | Ga0123355_10000254 | 3300009826 | Bacteria | 68581 |
| 68 | Ga0123356_10047274 | 3300010049 | Bacteria | 4004 |
| 69 | Ga0123356_10117279 | 3300010049 | Bacteria | 2583 |
| 70 | Ga0123356_10126161 | 3300010049 | Bacteria | 2499 |
| 71 | Ga0123356_10140853 | 3300010049 | Bacteria | 2379 |
| 72 | Ga0123356_10422970 | 3300010049 | Bacteria | 1475 |
| 73 | Ga0123356_11513077 | 3300010049 | Bacteria | 828 |
| 74 | Ga0123353_10082120 | 3300010167 | Bacteria | 5183 |
| 75 | Ga0123353_10165958 | 3300010167 | Bacteria | 3509 |
| 76 | Ga0123353_10231222 | 3300010167 | Bacteria | 2882 |
| 77 | Ga0123353_10545358 | 3300010167 | Bacteria | 1674 |
| 78 | Ga0123354_10456675 | 3300010882 | Bacteria | 1030 |
| 79 | Ga0466713_143277 | 3300042602 | Bacteria | 6058 |
| 80 | Ga0466722_081916 | 3300042609 | Bacteria | 2146 |
| 81 | Ga0466726_273686 | 3300042619 | Bacteria | 1112 |
| 82 | Ga0415639_035793 | 3300038395 | Bacteria | 3288 |
| 83 | Ga0123355_10915009 | 3300009826 | Bacteria | 950 |
| 84 | Ga0123356_10009064 | 3300010049 | Bacteria | 9840 |
| 85 | Ga0123356_10017599 | 3300010049 | Bacteria | 6799 |
| 86 | Ga0123356_10057581 | 3300010049 | Bacteria | 3623 |
| 87 | Ga0123356_10357584 | 3300010049 | Bacteria | 1586 |
| 88 | Ga0123356_10383616 | 3300010049 | Bacteria | 1538 |
| 89 | Ga0123356_10448224 | 3300010049 | Unclassified | 1438 |
| 90 | Ga0123356_10977542 | 3300010049 | Bacteria | 1017 |
| 91 | Ga0123356_11128748 | 3300010049 | Bacteria | 952 |
| 92 | Ga0123356_11268226 | 3300010049 | Bacteria | 901 |
| 93 | Ga0123356_11679995 | 3300010049 | Bacteria | 787 |
| 94 | Ga0123356_11694842 | 3300010049 | Bacteria | 784 |
| 95 | Ga0123353_10110600 | 3300010167 | Bacteria | 4426 |
| 96 | Ga0123353_10237468 | 3300010167 | Bacteria | 2835 |
| 97 | Ga0123353_10321956 | 3300010167 | Bacteria | 2346 |
| 98 | Ga0123353_10412430 | 3300010167 | Bacteria | 2005 |
| 99 | Ga0123353_10427024 | 3300010167 | Bacteria | 1961 |
| 100 | Ga0123353_10483483 | 3300010167 | Bacteria | 1811 |
| 101 | Ga0123353_10754095 | 3300010167 | Bacteria | 1354 |
| 102 | Ga0123353_11194944 | 3300010167 | Bacteria | 999 |
| 103 | Ga0123354_10133078 | 3300010882 | Bacteria | 3128 |
| 104 | Ga0123355_10361032 | 3300009826 | Bacteria | 1913 |
| 105 | Ga0123356_10013226 | 3300010049 | Bacteria | 7981 |
| 106 | Ga0123356_10042461 | 3300010049 | Bacteria | 4236 |
| 107 | Ga0123356_10568619 | 3300010049 | Bacteria | 1296 |
| 108 | Ga0123356_10618124 | 3300010049 | Bacteria | 1249 |
| 109 | Ga0123356_10623973 | 3300010049 | Bacteria | 1244 |
| 110 | Ga0123353_10076583 | 3300010167 | Bacteria | 5375 |
| 111 | Ga0123353_10479653 | 3300010167 | Bacteria | 1820 |
| 112 | Ga0123353_10773919 | 3300010167 | Bacteria | 1331 |
| 113 | Ga0466731_194025 | 3300042622 | Bacteria | 1148 |
| 114 | Ga0466725_264074 | 3300042654 | Bacteria | 3033 |
| 115 | JGI24695J34938_10002253 | 3300002450 | Bacteria | 14922 |
| 116 | Ga0466714_170143 | 3300042603 | Bacteria | 8978 |
MSA Aligner
Geographic Distribution
Some samples may be missing due to lack of coordinate data.