Protein Family IF02862

Metagenome Metatranscriptome Isolate
129 Members
47 Samples
115 Scaffolds
288.15 Avg Length

🧬 Representative Sequence

ID
3300010049|Ga0123356_10220177|Ga0123356_102201772
Length
327 aa
Sequence
MNNSDSAGLRPVQRLSAAERQGTDGNACAYHCVKEITMKKTFSIAVTVILLFAWQLPLFAGGARDSGDKAVPIKGKIILSTTTSTQDSGLLDFILPVFTRETGWETDVIAVGSGAALRMGRDGDADVLLVHARQDEIKFVEDGYGLKRYDVMYNDFLVAGPDLSAIAHNDDVIQTFRDIASKNLPFVSRGDDSGTHRMELNLWQTAGIDVRNIPAYAAVGQGMGATLQMAHEMRAYTLTDRATWLILARDGKINLPAVCEKAPSLLNYYGVILVNPESHQHINAEGGQAFINWIISDSAQQLIGQYGLAEFGGALFTPNASANIMP*

📊 Sample Types

Isolate 10.8%
Metagenome 88.4%
MAG 0.0%
Metatranscriptome 0.8%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 47.8%
Unclassified 28.3%
Kalotermitidae 13.0%
Termopsidae 6.5%
Rhinotermitidae 4.3%

🌳 Taxonomy

Archaea 0
Bacteria 119
Eukaryota 0
Viruses 1
Unclassified 9

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125661 Treponema sp. Emb289P3bin69 Isolate Unclassified
2 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
3 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
4 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
5 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
6 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
7 2781125634 Treponema sp. Co191P1bin45 Isolate Unclassified
8 2781125681 Treponema sp. Lab288P1bin11 Isolate Unclassified
9 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
10 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
11 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
12 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
13 2781125650 Treponema sp. Co191P3bin64 Isolate Unclassified
14 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
15 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
16 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
17 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
18 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
19 2781125640 Treponema sp. Co191P1bin37 Isolate Unclassified
20 2819994798 Unclassified Spirochaetes Th196P1bin3 Isolate Unclassified
21 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
22 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
23 2781125660 Treponema sp. Emb289P3bin52 Isolate Unclassified
24 2781125687 Treponema sp. Lab288P4bin29 Isolate Unclassified
25 2781125696 Treponema sp. Th196P4bin22 Isolate Unclassified
26 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
27 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
28 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
29 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
30 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
31 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
32 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
33 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
34 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
35 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
36 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
37 2781125656 Treponema sp. Emb289P1bin65 Isolate Unclassified
38 2781125665 Treponema sp. Emb289P3bin117 Isolate Unclassified
39 2820587002 Unclassified Firmicutes Emb289P1bin94 Isolate Unclassified
40 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
41 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
42 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
43 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
44 2781125657 Treponema sp. Emb289P3bin15 Isolate Unclassified
45 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
46 3300022820 Termite gut microbial communities from Nasutitermes sp. nest - French Guiana - 36-11 mRNA Metatranscriptome Termitidae
47 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466700_308378 3300042600 Bacteria 8354
2 Ga0466700_471707 3300042600 Bacteria 1061
3 Ga0466719_459580 3300042606 Bacteria 29110
4 Ga0123355_10002137 3300009826 Bacteria 27909
5 Ga0123356_10004007 3300010049 Bacteria 15298
6 Ga0123356_10118737 3300010049 Bacteria 2568
7 Ga0123353_10121776 3300010167 Bacteria 4194
8 JGI24695J34938_10002782 3300002450 Bacteria 12821
9 JGI24695J34938_10049688 3300002450 Bacteria 1842
10 JGI24700J35501_10930281 3300002508 Bacteria 12731
11 Ga0415639_080267 3300038395 Bacteria 11605
12 Ga0415639_086388 3300038395 Bacteria 7713
13 Ga0466690_050356 3300042590 Bacteria 26222
14 Ga0466699_127878 3300042597 Bacteria 7728
15 Ga0466699_311152 3300042597 Bacteria 1688
16 Ga0466722_185308 3300042609 Bacteria 17287
17 Ga0123355_10001569 3300009826 Bacteria 31898
18 Ga0123353_10134075 3300010167 Unclassified 3973
19 Ga0123353_10314514 3300010167 Bacteria 2381
20 Ga0123354_10029144 3300010882 Unclassified 8689
21 JGI24698J34947_10042894 3300002449 Bacteria 2322
22 JGI24695J34938_10003482 3300002450 Bacteria 10942
23 JGI24702J35022_10061507 3300002462 Bacteria 2009
24 Ga0466692_113311 3300042591 Bacteria 3020
25 Ga0466732_270756 3300042656 Bacteria 6624
26 Ga0466732_313352 3300042656 Bacteria 12372
27 Ga0466718_156133 3300042617 Bacteria 1458
28 Ga0466700_347371 3300042600 Bacteria 1164
29 Ga0466719_054448 3300042606 Unclassified 2076
30 Ga0123355_10127241 3300009826 Bacteria 3933
31 Ga0123356_10075888 3300010049 Bacteria 3167
32 Ga0123356_10166519 3300010049 Bacteria 2209
33 Ga0123356_10629607 3300010049 Bacteria 1239
34 JGI24695J34938_10000193 3300002450 Bacteria 56989
35 JGI24695J34938_10015974 3300002450 Bacteria 3833
36 JGI24702J35022_10001698 3300002462 Bacteria 13653
37 Ga0072941_1039237 3300005201 Bacteria 9392
38 Ga0072941_1039239 3300005201 Bacteria 17770
39 Ga0072941_1203116 3300005201 Bacteria 1969
40 Ga0415639_038100 3300038395 Bacteria 10691
41 Ga0466692_073514 3300042591 Bacteria 12002
42 Ga0466726_414007 3300042619 Bacteria 1751
43 Ga0466721_134886 3300042608 Bacteria 2478
44 Ga0123357_10270141 3300009784 Bacteria 1779
45 Ga0123357_10381375 3300009784 Unclassified 1308
46 Ga0123356_10004827 3300010049 Bacteria 13874
47 Ga0123356_10015590 3300010049 Unclassified 7278
48 Ga0123353_10329596 3300010167 Bacteria 2311
49 Ga0466725_138286 3300042654 Bacteria 3132
50 Ga0466727_164983 3300042655 Bacteria 1551
51 Ga0255809_1067954 3300022820 Bacteria 1174
52 Ga0415639_005606 3300038395 Bacteria 11776
53 Ga0415639_023007 3300038395 Bacteria 9442
54 Ga0466699_010147 3300042597 Bacteria 8991
55 Ga0466732_340999 3300042656 Bacteria 2306
56 Ga0466700_024801 3300042600 Bacteria 2445
57 Ga0466719_005449 3300042606 Bacteria 6404
58 Ga0123355_10000466 3300009826 Bacteria 53495
59 Ga0123355_10001282 3300009826 Bacteria 35097
60 Ga0123356_10000020 3300010049 Bacteria 177064
61 Ga0123356_10000309 3300010049 Bacteria 55893
62 Ga0123356_10000381 3300010049 Bacteria 50607
63 Ga0123356_10008768 3300010049 Bacteria 10021
64 Ga0123356_10210518 3300010049 Bacteria 1992
65 Ga0123356_10669298 3300010049 Bacteria 1206
66 JGI24695J34938_10003880 3300002450 Unclassified 10131
67 JGI24695J34938_10037382 3300002450 Bacteria 2206
68 JGI24702J35022_10001347 3300002462 Bacteria 15248
69 JGI24702J35022_10019575 3300002462 Bacteria 3681
70 Ga0466731_195042 3300042622 Bacteria 1233
71 Ga0466727_273660 3300042655 Bacteria 2884
72 Ga0415639_020182 3300038395 Bacteria 1708
73 Ga0466699_247997 3300042597 Bacteria 1676
74 Ga0466712_155617 3300042614 Bacteria 8183
75 Ga0466711_313501 3300042615 Bacteria 1577
76 Ga0466718_116825 3300042617 Bacteria 11670
77 Ga0466722_249972 3300042609 Bacteria 4142
78 Ga0123357_10043003 3300009784 Bacteria 6139
79 Ga0123357_10180058 3300009784 Bacteria 2471
80 Ga0123355_10506670 3300009826 Bacteria 1485
81 Ga0123356_10022073 3300010049 Unclassified 6011
82 Ga0123356_10220177 3300010049 Unclassified 1954
83 Ga0123353_10013035 3300010167 Bacteria 11877
84 Ga0123353_10169868 3300010167 Bacteria 3463
85 Ga0123354_10256273 3300010882 Bacteria 1759
86 JGI24698J34947_10001248 3300002449 Bacteria 13290
87 JGI24695J34938_10004911 3300002450 Unclassified 8553
88 JGI24695J34938_10007840 3300002450 Bacteria 6180
89 Ga0415639_127052 3300038395 Bacteria 1097
90 Ga0466726_226297 3300042619 Bacteria 3333
91 Ga0466719_043054 3300042606 Bacteria 3545
92 Ga0123356_10064489 3300010049 Bacteria 3425
93 Ga0123356_10103026 3300010049 Bacteria 2741
94 Ga0123356_10313067 3300010049 Viruses 1680
95 Ga0123353_10018813 3300010167 Bacteria 10234
96 Ga0123353_10023514 3300010167 Bacteria 9332
97 Ga0123353_10083229 3300010167 Bacteria 5148
98 Ga0415639_104234 3300038395 Bacteria 2435
99 Ga0466694_062195 3300042594 Bacteria 2712
100 Ga0466715_103227 3300042616 Bacteria 14756
101 Ga0466723_140934 3300042618 Bacteria 4483
102 Ga0466721_001747 3300042608 Bacteria 2336
103 Ga0123355_10000067 3300009826 Bacteria 112202
104 Ga0123353_10011003 3300010167 Bacteria 12697
105 JGI24698J34947_10023865 3300002449 Bacteria 3270
106 Ga0466731_123416 3300042622 Bacteria 2431
107 Ga0466731_411472 3300042622 Bacteria 5447
108 Ga0466735_172876 3300042624 Bacteria 1676
109 Ga0466702_273505 3300042635 Bacteria 2084
110 Ga0466708_024249 3300042652 Bacteria 2227
111 Ga0466708_139902 3300042652 Bacteria 5434
112 Ga0466694_113598 3300042594 Bacteria 1989
113 Ga0466694_136017 3300042594 Bacteria 1332
114 Ga0466695_327807 3300042595 Bacteria 4581
115 Ga0466699_245540 3300042597 Bacteria 1169

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300010049 Ga0123356_10064489 Ga0123356_100644892 234
2 3300009826 Ga0123355_10001282 Ga0123355_1000128213 252
3 3300042622 Ga0466731_123416 Ga0466731_123416_1363_2208 254
4 3300042597 Ga0466699_311152 Ga0466699_311152_325_1176 262
5 3300042590 Ga0466690_050356 Ga0466690_050356_2993_3886 264
6 3300042654 Ga0466725_138286 Ga0466725_138286_651_1451 266
7 3300042622 Ga0466731_195042 Ga0466731_195042_207_1097 270
8 iso_pr_bacteria 2820587002 2820587577 271
9 3300009826 Ga0123355_10000466 Ga0123355_1000046640 272
10 3300009826 Ga0123355_10002137 Ga0123355_1000213729 272
11 3300009826 Ga0123355_10127241 Ga0123355_101272414 272
12 3300009784 Ga0123357_10381375 Ga0123357_103813751 273
13 3300042609 Ga0466722_185308 Ga0466722_185308_2759_3667 275
14 3300042635 Ga0466702_273505 Ga0466702_273505_243_1073 276
15 iso_pr_bacteria 2781125640 2781288871 276
16 3300010049 Ga0123356_10015590 Ga0123356_100155906 278
17 3300010049 Ga0123356_10103026 Ga0123356_101030261 278
18 3300010049 Ga0123356_10000309 Ga0123356_1000030915 279
19 3300010049 Ga0123356_10022073 Ga0123356_100220734 280
20 3300042622 Ga0466731_411472 Ga0466731_411472_142_984 280
21 3300042655 Ga0466727_164983 Ga0466727_164983_237_1079 280
22 3300010049 Ga0123356_10075888 Ga0123356_100758882 281
23 3300042600 Ga0466700_308378 Ga0466700_308378_6110_6955 281
24 3300042600 Ga0466700_471707 Ga0466700_471707_111_956 281
25 3300010049 Ga0123356_10313067 Ga0123356_103130672 282
26 3300038395 Ga0415639_086388 Ga0415639_086388_1644_2492 282
27 3300042600 Ga0466700_347371 Ga0466700_347371_69_917 282
28 3300010167 Ga0123353_10011003 Ga0123353_1001100316 283
29 3300042614 Ga0466712_155617 Ga0466712_155617_4375_5226 283
30 iso_pr_bacteria 2819994798 2819996479 283
31 3300002449 JGI24698J34947_10023865 JGI24698J34947_100238655 284
32 3300002508 JGI24700J35501_10930281 JGI24700J35501_109302819 284
33 3300009826 Ga0123355_10506670 Ga0123355_105066702 284
34 3300010167 Ga0123353_10023514 Ga0123353_100235141 284
35 3300010167 Ga0123353_10314514 Ga0123353_103145143 284
36 3300038395 Ga0415639_104234 Ga0415639_104234_1376_2230 284
37 3300042597 Ga0466699_247997 Ga0466699_247997_625_1479 284
38 3300042619 Ga0466726_226297 Ga0466726_226297_712_1566 284
39 3300002450 JGI24695J34938_10002782 JGI24695J34938_1000278213 285
40 3300009826 Ga0123355_10000067 Ga0123355_1000006769 285
41 3300038395 Ga0415639_127052 Ga0415639_127052_10_894 285
42 3300042597 Ga0466699_127878 Ga0466699_127878_1661_2518 285
43 iso_pr_bacteria 2781125656 2781319758 285
44 3300042617 Ga0466718_156133 Ga0466718_156133_197_1057 286
45 3300042652 Ga0466708_139902 Ga0466708_139902_4506_5366 286
46 3300002450 JGI24695J34938_10004911 JGI24695J34938_100049115 287
47 3300002450 JGI24695J34938_10007840 JGI24695J34938_100078406 287
48 3300005201 Ga0072941_1203116 Ga0072941_12031162 287
49 3300009784 Ga0123357_10180058 Ga0123357_101800582 287
50 3300010049 Ga0123356_10210518 Ga0123356_102105182 287
51 3300010167 Ga0123353_10121776 Ga0123353_101217762 287
52 3300010167 Ga0123353_10169868 Ga0123353_101698682 287
53 3300010167 Ga0123353_10329596 Ga0123353_103295963 287
54 3300042594 Ga0466694_113598 Ga0466694_113598_159_1022 287
55 3300042597 Ga0466699_010147 Ga0466699_010147_3079_3942 287
56 3300042608 Ga0466721_134886 Ga0466721_134886_1591_2454 287
57 3300042615 Ga0466711_313501 Ga0466711_313501_313_1176 287
58 3300042656 Ga0466732_340999 Ga0466732_340999_190_1053 287
59 iso_pr_bacteria 2781125650 2781308429 287
60 iso_pr_bacteria 2781125665 2781341434 287
61 3300002450 JGI24695J34938_10003880 JGI24695J34938_100038808 288
62 3300002450 JGI24695J34938_10037382 JGI24695J34938_100373822 288
63 3300002462 JGI24702J35022_10001698 JGI24702J35022_1000169816 288
64 3300038395 Ga0415639_005606 Ga0415639_005606_6401_7267 288
65 3300042608 Ga0466721_001747 Ga0466721_001747_611_1477 288
66 3300042609 Ga0466722_249972 Ga0466722_249972_2811_3677 288
67 iso_pr_bacteria 2781125661 2781332762 288
68 3300002462 JGI24702J35022_10019575 JGI24702J35022_100195753 289
69 3300010049 Ga0123356_10000381 Ga0123356_1000038135 289
70 3300010167 Ga0123353_10018813 Ga0123353_100188132 289
71 3300005201 Ga0072941_1039237 Ga0072941_10392373 290
72 3300005201 Ga0072941_1039239 Ga0072941_103923915 290
73 3300010049 Ga0123356_10629607 Ga0123356_106296072 290
74 3300022820 Ga0255809_1067954 Ga0255809_10679541 290
75 3300042617 Ga0466718_116825 Ga0466718_116825_10043_10915 290
76 3300042656 Ga0466732_270756 Ga0466732_270756_4770_5642 290
77 3300042656 Ga0466732_313352 Ga0466732_313352_5663_6535 290
78 iso_pr_bacteria 2781125657 2781324492 290
79 3300002450 JGI24695J34938_10000193 JGI24695J34938_1000019318 291
80 3300009784 Ga0123357_10270141 Ga0123357_102701412 291
81 3300009826 Ga0123355_10001569 Ga0123355_1000156910 291
82 3300010049 Ga0123356_10004827 Ga0123356_100048277 291
83 3300042606 Ga0466719_043054 Ga0466719_043054_694_1569 291
84 3300042616 Ga0466715_103227 Ga0466715_103227_7004_7879 291
85 3300042652 Ga0466708_024249 Ga0466708_024249_321_1196 291
86 iso_pr_bacteria 2781125634 2781274130 291
87 iso_pr_bacteria 2781125634 2781275366 291
88 iso_pr_bacteria 2781125681 2781407116 291
89 3300002450 JGI24695J34938_10003482 JGI24695J34938_1000348210 292
90 3300002450 JGI24695J34938_10049688 JGI24695J34938_100496882 292
91 3300010882 Ga0123354_10256273 Ga0123354_102562732 292
92 3300038395 Ga0415639_080267 Ga0415639_080267_4833_5711 292
93 3300002462 JGI24702J35022_10061507 JGI24702J35022_100615072 293
94 3300010049 Ga0123356_10008768 Ga0123356_100087686 293
95 3300010049 Ga0123356_10166519 Ga0123356_101665193 293
96 3300042594 Ga0466694_062195 Ga0466694_062195_393_1274 293
97 3300042619 Ga0466726_414007 Ga0466726_414007_230_1111 293
98 iso_pr_bacteria 2781125660 2781329711 293
99 3300010049 Ga0123356_10000020 Ga0123356_1000002014 294
100 3300010167 Ga0123353_10083229 Ga0123353_100832293 294
101 3300042591 Ga0466692_073514 Ga0466692_073514_6825_7709 294
102 3300042594 Ga0466694_136017 Ga0466694_136017_130_1014 294
103 3300042606 Ga0466719_005449 Ga0466719_005449_5266_6150 294
104 3300042606 Ga0466719_054448 Ga0466719_054448_577_1461 294
105 3300042606 Ga0466719_459580 Ga0466719_459580_577_1461 294
106 3300042624 Ga0466735_172876 Ga0466735_172876_478_1398 294
107 3300002449 JGI24698J34947_10001248 JGI24698J34947_100012482 295
108 3300010049 Ga0123356_10118737 Ga0123356_101187372 295
109 3300002450 JGI24695J34938_10015974 JGI24695J34938_100159741 296
110 3300010049 Ga0123356_10004007 Ga0123356_100040079 297
111 3300038395 Ga0415639_023007 Ga0415639_023007_5344_6237 297
112 3300042600 Ga0466700_024801 Ga0466700_024801_618_1511 297
113 3300002449 JGI24698J34947_10042894 JGI24698J34947_100428943 298
114 3300009784 Ga0123357_10043003 Ga0123357_100430031 298
115 3300010167 Ga0123353_10134075 Ga0123353_101340754 298
116 3300038395 Ga0415639_020182 Ga0415639_020182_288_1187 299
117 3300010882 Ga0123354_10029144 Ga0123354_100291448 300
118 3300042618 Ga0466723_140934 Ga0466723_140934_3284_4243 300
119 3300042595 Ga0466695_327807 Ga0466695_327807_2106_3017 303
120 3300038395 Ga0415639_038100 Ga0415639_038100_4289_5203 304
121 3300010049 Ga0123356_10669298 Ga0123356_106692981 305
122 3300042591 Ga0466692_113311 Ga0466692_113311_1223_2140 305
123 3300042597 Ga0466699_245540 Ga0466699_245540_129_1046 305
124 3300002462 JGI24702J35022_10001347 JGI24702J35022_1000134712 306
125 3300042655 Ga0466727_273660 Ga0466727_273660_1769_2710 313
126 iso_pr_bacteria 2781125687 2781420058 317
127 3300010167 Ga0123353_10013035 Ga0123353_100130352 323
128 iso_pr_bacteria 2781125696 2781441528 326
129 3300010049 Ga0123356_10220177 Ga0123356_102201772 327

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF12849 PBP_like_2 PBP superfamily domain 78 297 0.91
PF12727 PBP_like PBP superfamily domain 102 219 0.86
PF13531 SBP_bac_11 Bacterial extracellular solute-binding protein 91 308 0.83

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.7 0.81 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.