Protein Family IF02834

Metagenome Isolate
132 Members
31 Samples
124 Scaffolds
354.7 Avg Length

🧬 Representative Sequence

ID
3300010049|Ga0123356_10152891|Ga0123356_101528912
Length
379 aa
Sequence
MLNPPLPVTPHRDILYKKEGNMTTRMRGLNMGGWLSQIDAIQEKDPQKFPGIDKHMETFIGDADYANVKSWGFDHVRIPVDSYLFFNDDEQPIESRIKNLDRAVELAKKNGLKMILDLHECPGHDFSEVTKSPVQKLFAEDDTYIKKTEKIWAYLAERYGQNDHVIFETLNEPVAPTPEIWNTVKDRLCRQIRSHAPKSTIMTGSNMWNWPNLFSSLTPFEDDNIIYSVHFYEPLLFTHQKAPWMTNSPEILIERTYPEDYGPGFIRKYGFTQSPGKWDRNRIMQEFEPVSAFSKKYNAPVICNEFGVYTPVELQAQLRWYDDLLSVLKEMGIGFSYWNYKNLDFGIISIGESLHENLPQYNNSERINHPVLDVLRKY*

📊 Sample Types

Isolate 6.1%
Metagenome 93.9%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 72.4%
Unclassified 27.6%

🌳 Taxonomy

Archaea 2
Bacteria 124
Eukaryota 0
Viruses 0
Unclassified 6

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2740892547 Fibrobacteria bacterium GUT77 MC_77 Isolate Unclassified
2 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
3 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
4 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
5 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
6 2778260936 Unclassified Fibrobacteres Co191P3bin13 Isolate Unclassified
7 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
8 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
9 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
10 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
11 2778260935 Unclassified Fibrobacteres Co191P1bin79 Isolate Unclassified
12 2778260938 Unclassified Fibrobacteres Co191P3bin71 Isolate Unclassified
13 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
14 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
15 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
16 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
17 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
18 2781125659 Treponema sp. Emb289P3bin114 Isolate Unclassified
19 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
20 2781125660 Treponema sp. Emb289P3bin52 Isolate Unclassified
21 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
22 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
23 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
24 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
25 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
26 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
27 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
28 2773857778 Unclassified Fibrobacteres Co191P1bin56 Isolate Unclassified
29 2781125657 Treponema sp. Emb289P3bin15 Isolate Unclassified
30 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
31 3300005200 Nasutitermes gut metagenome Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466712_056447 3300042614 Bacteria 22158
2 Ga0123356_10000882 3300010049 Bacteria 33318
3 Ga0415639_126041 3300038395 Bacteria 5100
4 Ga0466699_108852 3300042597 Bacteria 9663
5 Ga0466699_119151 3300042597 Bacteria 15430
6 AustNasuHG_c1003713 3300000089 Bacteria 5505
7 AustNasuHG_c1003895 3300000089 Bacteria 5376
8 JGI24698J34947_10032349 3300002449 Bacteria 2747
9 JGI24695J34938_10047231 3300002450 Bacteria 1902
10 Ga0074263_100636 3300005485 Bacteria 5240
11 Ga0466720_230962 3300042607 Bacteria 37058
12 Ga0466698_079416 3300042610 Bacteria 9166
13 Ga0466712_126441 3300042614 Bacteria 83990
14 Ga0466718_028768 3300042617 Bacteria 32476
15 Ga0466718_097410 3300042617 Bacteria 12242
16 Ga0264413_100647 3300024493 Bacteria 11298
17 Ga0466693_106678 3300042592 Bacteria 5806
18 Ga0466699_220706 3300042597 Bacteria 2581
19 JGI24698J34947_10007513 3300002449 Bacteria 5988
20 Ga0072941_1001379 3300005201 Unclassified 5549
21 Ga0072941_1024167 3300005201 Unclassified 1523
22 Ga0466720_008599 3300042607 Bacteria 7327
23 Ga0466720_033743 3300042607 Bacteria 60959
24 Ga0466720_150739 3300042607 Bacteria 7098
25 Ga0466720_191913 3300042607 Bacteria 30939
26 Ga0466702_074380 3300042635 Bacteria 1588
27 Ga0466732_376931 3300042656 Bacteria 10112
28 Ga0466712_003489 3300042614 Bacteria 9502
29 Ga0466712_111274 3300042614 Bacteria 3015
30 Ga0466712_286882 3300042614 Bacteria 1786
31 Ga0466718_052209 3300042617 Archaea 1446
32 Ga0466718_071844 3300042617 Bacteria 11193
33 Ga0123356_10146862 3300010049 Bacteria 2334
34 Ga0123353_10319059 3300010167 Archaea 2359
35 Ga0264413_100605 3300024493 Bacteria 14161
36 Ga0264413_101833 3300024493 Bacteria 5299
37 Ga0466694_067606 3300042594 Bacteria 11085
38 Ga0466699_155464 3300042597 Bacteria 9710
39 JGI24698J34947_10034350 3300002449 Bacteria 2655
40 JGI24698J34947_10042592 3300002449 Bacteria 2332
41 JGI24695J34938_10000466 3300002450 Bacteria 39377
42 Ga0466720_168388 3300042607 Bacteria 12920
43 Ga0466731_065907 3300042622 Bacteria 5475
44 Ga0466712_148705 3300042614 Bacteria 3384
45 Ga0466712_271950 3300042614 Bacteria 20534
46 Ga0466712_318339 3300042614 Bacteria 3475
47 Ga0466718_071437 3300042617 Bacteria 18319
48 Ga0123356_10000079 3300010049 Bacteria 103173
49 Ga0123356_10002369 3300010049 Bacteria 20209
50 Ga0123356_10023000 3300010049 Unclassified 5875
51 Ga0466699_035491 3300042597 Bacteria 3636
52 Ga0466699_103848 3300042597 Bacteria 9860
53 Ga0466699_244901 3300042597 Bacteria 4691
54 JGI24698J34947_10013962 3300002449 Bacteria 4377
55 JGI24698J34947_10044046 3300002449 Bacteria 2285
56 Ga0072940_1027125 3300005200 Unclassified 1944
57 Ga0072941_1001381 3300005201 Bacteria 1971
58 Ga0466720_044800 3300042607 Bacteria 4133
59 Ga0466720_076209 3300042607 Bacteria 10623
60 Ga0466702_342215 3300042635 Bacteria 7586
61 Ga0466712_047015 3300042614 Bacteria 11870
62 Ga0466712_127822 3300042614 Bacteria 18158
63 Ga0466712_218933 3300042614 Bacteria 3358
64 Ga0466718_026240 3300042617 Bacteria 37188
65 Ga0466718_147564 3300042617 Bacteria 1942
66 Ga0123356_10134970 3300010049 Bacteria 2424
67 Ga0264413_101832 3300024493 Bacteria 9119
68 Ga0466694_198518 3300042594 Bacteria 9455
69 AustNasuHG_c1015964 3300000089 Bacteria 2522
70 JGI24698J34947_10006494 3300002449 Bacteria 6417
71 JGI24698J34947_10018198 3300002449 Bacteria 3799
72 JGI24698J34947_10021671 3300002449 Unclassified 3453
73 JGI24702J35022_10006201 3300002462 Bacteria 6926
74 Ga0466720_012093 3300042607 Bacteria 12751
75 Ga0466720_035084 3300042607 Bacteria 9872
76 Ga0466720_061587 3300042607 Bacteria 12424
77 Ga0466720_147828 3300042607 Bacteria 8332
78 Ga0466732_142729 3300042656 Bacteria 25250
79 Ga0466732_354358 3300042656 Bacteria 6997
80 Ga0466718_117216 3300042617 Bacteria 15277
81 Ga0123356_10000239 3300010049 Bacteria 63302
82 Ga0123356_10012145 3300010049 Bacteria 8371
83 Ga0466699_106348 3300042597 Bacteria 4032
84 Ga0466699_308049 3300042597 Bacteria 5138
85 JGI24695J34938_10000516 3300002450 Bacteria 37602
86 JGI24695J34938_10044666 3300002450 Bacteria 1969
87 Ga0072940_1010827 3300005200 Bacteria 8766
88 Ga0072940_1018160 3300005200 Bacteria 1548
89 Ga0072941_1005267 3300005201 Bacteria 15589
90 Ga0466720_187324 3300042607 Bacteria 4922
91 Ga0466721_334270 3300042608 Bacteria 25952
92 Ga0466712_049628 3300042614 Bacteria 10879
93 Ga0466712_079544 3300042614 Bacteria 4750
94 Ga0466712_134770 3300042614 Bacteria 5168
95 Ga0466712_153311 3300042614 Bacteria 5138
96 Ga0466718_093531 3300042617 Bacteria 2609
97 Ga0123356_10000007 3300010049 Bacteria 240704
98 Ga0123356_10152891 3300010049 Bacteria 2294
99 JGI24695J34938_10004420 3300002450 Bacteria 9234
100 Ga0072940_1011176 3300005200 Bacteria 2972
101 Ga0072940_1027124 3300005200 Bacteria 1578
102 Ga0072941_1000953 3300005201 Bacteria 66255
103 Ga0466732_040664 3300042656 Bacteria 20526
104 Ga0466732_263983 3300042656 Bacteria 1547
105 Ga0466712_097030 3300042614 Bacteria 2386
106 Ga0466712_209126 3300042614 Bacteria 6366
107 Ga0123356_10003153 3300010049 Bacteria 17345
108 Ga0123356_10017617 3300010049 Unclassified 6796
109 Ga0123356_10210399 3300010049 Bacteria 1993
110 Ga0466694_056442 3300042594 Bacteria 8524
111 JGI24698J34947_10000841 3300002449 Bacteria 15401
112 JGI24698J34947_10002370 3300002449 Bacteria 10143
113 JGI24698J34947_10042161 3300002449 Bacteria 2346
114 JGI24697J35500_11135392 3300002507 Bacteria 1286
115 Ga0072940_1151870 3300005200 Bacteria 8983
116 Ga0072941_1021564 3300005201 Bacteria 10609
117 Ga0072941_1025015 3300005201 Bacteria 3282
118 Ga0072941_1131755 3300005201 Bacteria 1402
119 Ga0466720_034483 3300042607 Bacteria 3415
120 Ga0466720_121013 3300042607 Bacteria 11711
121 Ga0466720_147873 3300042607 Bacteria 6065
122 Ga0466702_290508 3300042635 Bacteria 4843
123 Ga0466702_324219 3300042635 Bacteria 2227
124 Ga0466702_385816 3300042635 Bacteria 1476

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00150 Cellulase Cellulase (glycosyl hydrolase family 5) 48 342 0.86

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.