Protein Family IF02758
Metagenome
Isolate
118
Members
38
Samples
110
Scaffolds
397.14
Avg Length
Representative Sequence
- ID
- 3300010049|Ga0123356_10051012|Ga0123356_100510123
- Length
- 425 aa
- Sequence
- VRIAILGGGFNPIHLGHLYLADTVLSLGFVDRVVFVPAYRSPLKLAAKGMEKSANDRLLMIAVSIAGNPRLSLDACEINREGTSYTIDTLEDIITRYCPDGKPSLIIGDDLAPEFPKWNKYEKITKLADVIIARRNAKTEIKYPFQNIQITNDVLDISSAMVRERINDGSDWRSLVPEAVCNIIEDRQLYGLTAGCSDKREHSDENPGKCAIIKKENGLPELTHSMQASINEPRNAVILRIEEAVRENTGFQRFLHSRNTAVLAWDLCRHFGLDPDLGYLAGIAHDLAKTIKADILFELVKNDGYGISKLEMSKPSLLHGRASAVLLKEQFNIHNEDVLEAVAFHTGGREGMCQLAKVVYIADKLEVTRDGVDPDMRKMCYKEKNLDSLLFTVLENTISGLQTKKLELSEDTFKLLARMKEKNI*
Sample Types
Isolate
6.8%
Metagenome
93.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
41.7%
Kalotermitidae
27.8%
Unclassified
22.2%
Rhinotermitidae
5.6%
Termopsidae
2.8%
Taxonomy
Archaea
0
Bacteria
113
Eukaryota
0
Viruses
0
Unclassified
5
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 2 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 3 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 4 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 5 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 6 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 7 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 8 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 9 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 10 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 11 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 12 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 13 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 14 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 15 | 2781125650 | Treponema sp. Co191P3bin64 | Isolate | Unclassified |
| 16 | 2781125651 | Treponema sp. Co191P3bin8 | Isolate | Unclassified |
| 17 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 18 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 19 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 20 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 21 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 22 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 23 | 2781125693 | Treponema sp. Th196P3bin148 | Isolate | Unclassified |
| 24 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 25 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 26 | 2781125659 | Treponema sp. Emb289P3bin114 | Isolate | Unclassified |
| 27 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 28 | 2781125695 | Treponema sp. Th196P4bin30 | Isolate | Unclassified |
| 29 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 30 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 31 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 32 | 2781125645 | Treponema sp. Co191P3bin32 | Isolate | Unclassified |
| 33 | 2781125663 | Treponema sp. Emb289P3bin135 | Isolate | Unclassified |
| 34 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 35 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 36 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 37 | 2781125635 | Treponema sp. Co191P1bin60 | Isolate | Unclassified |
| 38 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0264413_102585 | 3300024493 | Bacteria | 4948 |
| 2 | Ga0466692_078847 | 3300042591 | Bacteria | 7398 |
| 3 | Ga0466694_028560 | 3300042594 | Bacteria | 27113 |
| 4 | Ga0466695_290770 | 3300042595 | Bacteria | 97007 |
| 5 | Ga0123356_10009820 | 3300010049 | Bacteria | 9428 |
| 6 | Ga0123356_10051012 | 3300010049 | Bacteria | 3849 |
| 7 | Ga0466715_150692 | 3300042616 | Bacteria | 17974 |
| 8 | Ga0466728_034112 | 3300042620 | Bacteria | 27725 |
| 9 | JGI24695J34938_10009583 | 3300002450 | Bacteria | 5374 |
| 10 | Ga0072941_1075112 | 3300005201 | Bacteria | 4838 |
| 11 | Ga0466692_187429 | 3300042591 | Bacteria | 5037 |
| 12 | Ga0466694_268885 | 3300042594 | Bacteria | 17270 |
| 13 | Ga0466699_076644 | 3300042597 | Bacteria | 9216 |
| 14 | Ga0466699_274412 | 3300042597 | Bacteria | 7094 |
| 15 | Ga0466699_314935 | 3300042597 | Bacteria | 35477 |
| 16 | Ga0466699_364451 | 3300042597 | Bacteria | 5728 |
| 17 | Ga0466699_403262 | 3300042597 | Bacteria | 3217 |
| 18 | Ga0123356_10001174 | 3300010049 | Bacteria | 28989 |
| 19 | Ga0123356_10004193 | 3300010049 | Bacteria | 14942 |
| 20 | Ga0123353_10244106 | 3300010167 | Bacteria | 2788 |
| 21 | Ga0466712_191349 | 3300042614 | Bacteria | 2303 |
| 22 | Ga0466735_066995 | 3300042624 | Bacteria | 3011 |
| 23 | Ga0466704_286649 | 3300042643 | Bacteria | 10797 |
| 24 | Ga0466732_078911 | 3300042656 | Bacteria | 3173 |
| 25 | Ga0466699_001667 | 3300042597 | Bacteria | 4556 |
| 26 | Ga0466699_029977 | 3300042597 | Bacteria | 17208 |
| 27 | Ga0466699_371288 | 3300042597 | Bacteria | 3522 |
| 28 | Ga0466715_436350 | 3300042616 | Bacteria | 24104 |
| 29 | Ga0466723_085936 | 3300042618 | Bacteria | 4250 |
| 30 | Ga0466728_103464 | 3300042620 | Bacteria | 27893 |
| 31 | Ga0466703_023711 | 3300042636 | Bacteria | 21658 |
| 32 | JGI24698J34947_10029995 | 3300002449 | Unclassified | 2870 |
| 33 | JGI24695J34938_10000523 | 3300002450 | Bacteria | 37385 |
| 34 | JGI24695J34938_10007527 | 3300002450 | Bacteria | 6359 |
| 35 | Ga0072941_1054854 | 3300005201 | Bacteria | 5030 |
| 36 | Ga0072941_1255798 | 3300005201 | Bacteria | 2411 |
| 37 | Ga0466720_027935 | 3300042607 | Bacteria | 23895 |
| 38 | Ga0466720_107645 | 3300042607 | Bacteria | 4275 |
| 39 | Ga0466720_220932 | 3300042607 | Bacteria | 2542 |
| 40 | Ga0466698_472965 | 3300042610 | Bacteria | 1570 |
| 41 | Ga0264413_115759 | 3300024493 | Bacteria | 6730 |
| 42 | Ga0415639_149539 | 3300038395 | Bacteria | 3047 |
| 43 | Ga0466692_153769 | 3300042591 | Bacteria | 29297 |
| 44 | Ga0466699_068034 | 3300042597 | Bacteria | 3614 |
| 45 | Ga0466699_101922 | 3300042597 | Bacteria | 1715 |
| 46 | Ga0466699_227303 | 3300042597 | Bacteria | 3983 |
| 47 | Ga0466699_261512 | 3300042597 | Bacteria | 3477 |
| 48 | Ga0466718_023428 | 3300042617 | Bacteria | 58531 |
| 49 | JGI24698J34947_10006517 | 3300002449 | Bacteria | 6406 |
| 50 | JGI24695J34938_10002280 | 3300002450 | Bacteria | 14811 |
| 51 | JGI24695J34938_10012952 | 3300002450 | Bacteria | 4396 |
| 52 | Ga0072941_1000702 | 3300005201 | Bacteria | 30804 |
| 53 | Ga0072941_1016935 | 3300005201 | Bacteria | 5280 |
| 54 | Ga0466722_138095 | 3300042609 | Bacteria | 43949 |
| 55 | Ga0264413_103002 | 3300024493 | Bacteria | 5070 |
| 56 | Ga0466690_118746 | 3300042590 | Bacteria | 29260 |
| 57 | Ga0466691_190345 | 3300042593 | Bacteria | 4089 |
| 58 | Ga0466696_119168 | 3300042596 | Bacteria | 73376 |
| 59 | Ga0466699_067065 | 3300042597 | Bacteria | 1467 |
| 60 | Ga0466699_255510 | 3300042597 | Bacteria | 8120 |
| 61 | Ga0466712_079852 | 3300042614 | Bacteria | 15334 |
| 62 | Ga0466718_065755 | 3300042617 | Unclassified | 14643 |
| 63 | Ga0466703_292399 | 3300042636 | Bacteria | 55753 |
| 64 | Ga0466709_321768 | 3300042648 | Bacteria | 2600 |
| 65 | JGI24698J34947_10006644 | 3300002449 | Bacteria | 6351 |
| 66 | JGI24698J34947_10057263 | 3300002449 | Bacteria | 1934 |
| 67 | JGI24702J35022_10012820 | 3300002462 | Unclassified | 4651 |
| 68 | Ga0466722_063479 | 3300042609 | Bacteria | 17581 |
| 69 | Ga0466722_190971 | 3300042609 | Bacteria | 12252 |
| 70 | Ga0466690_036722 | 3300042590 | Bacteria | 5105 |
| 71 | Ga0466694_078502 | 3300042594 | Bacteria | 33638 |
| 72 | Ga0466699_146529 | 3300042597 | Bacteria | 18494 |
| 73 | Ga0123356_10011162 | 3300010049 | Unclassified | 8771 |
| 74 | Ga0466712_002114 | 3300042614 | Bacteria | 9969 |
| 75 | Ga0466712_137759 | 3300042614 | Bacteria | 3643 |
| 76 | Ga0466712_144144 | 3300042614 | Bacteria | 19900 |
| 77 | Ga0466723_022580 | 3300042618 | Bacteria | 17889 |
| 78 | Ga0466703_160467 | 3300042636 | Bacteria | 5341 |
| 79 | JGI24698J34947_10010696 | 3300002449 | Bacteria | 5036 |
| 80 | Ga0074263_112446 | 3300005485 | Bacteria | 2387 |
| 81 | Ga0466698_328841 | 3300042610 | Bacteria | 2559 |
| 82 | Ga0466732_011324 | 3300042656 | Bacteria | 3888 |
| 83 | Ga0415639_191874 | 3300038395 | Bacteria | 1824 |
| 84 | Ga0466692_086230 | 3300042591 | Bacteria | 7172 |
| 85 | Ga0466691_032823 | 3300042593 | Bacteria | 18574 |
| 86 | Ga0466694_044047 | 3300042594 | Bacteria | 4569 |
| 87 | Ga0466699_055698 | 3300042597 | Bacteria | 7941 |
| 88 | Ga0466699_123446 | 3300042597 | Bacteria | 8666 |
| 89 | Ga0123356_10000673 | 3300010049 | Bacteria | 37817 |
| 90 | Ga0123356_10004344 | 3300010049 | Bacteria | 14657 |
| 91 | Ga0123353_10085671 | 3300010167 | Bacteria | 5074 |
| 92 | Ga0466712_013410 | 3300042614 | Bacteria | 3609 |
| 93 | Ga0466712_065835 | 3300042614 | Bacteria | 6561 |
| 94 | Ga0466704_434890 | 3300042643 | Bacteria | 41687 |
| 95 | JGI24698J34947_10005898 | 3300002449 | Bacteria | 6714 |
| 96 | JGI24698J34947_10008849 | 3300002449 | Bacteria | 5526 |
| 97 | JGI24695J34938_10000637 | 3300002450 | Bacteria | 33482 |
| 98 | JGI24695J34938_10037169 | 3300002450 | Bacteria | 2215 |
| 99 | Ga0466705_127843 | 3300042612 | Bacteria | 14569 |
| 100 | Ga0466692_170504 | 3300042591 | Bacteria | 1791 |
| 101 | Ga0466691_118331 | 3300042593 | Bacteria | 63226 |
| 102 | Ga0466694_043622 | 3300042594 | Bacteria | 5303 |
| 103 | Ga0466694_349415 | 3300042594 | Bacteria | 3934 |
| 104 | Ga0123356_10002837 | 3300010049 | Bacteria | 18343 |
| 105 | Ga0123353_10015338 | 3300010167 | Bacteria | 11124 |
| 106 | Ga0466712_116315 | 3300042614 | Bacteria | 1578 |
| 107 | Ga0466712_127955 | 3300042614 | Bacteria | 54818 |
| 108 | Ga0466718_078288 | 3300042617 | Bacteria | 22152 |
| 109 | JGI24695J34938_10013679 | 3300002450 | Unclassified | 4249 |
| 110 | Ga0466720_026260 | 3300042607 | Bacteria | 25590 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.