Protein Family IF02671
Metagenome
Isolate
130
Members
39
Samples
116
Scaffolds
289.27
Avg Length
Representative Sequence
- ID
- 3300010049|Ga0123356_10005099|Ga0123356_1000509913
- Length
- 328 aa
- Sequence
- MGLGYLVVATDVILRICGTVKCSIDAFFLLHGTIMEVVNMTKLKAQVFEGILSVVVNAVLFGIKFWAGLVTGSIALIADAWHTLSDSFTSIFVIFSAKLSSQKPDEKHPFGHGRWEQISSIFIAFVLGIIAYDFMINSIERFKNRESVVYGTLAIVVTIVSIIVKELLAQYAFYLGRKTDNVIVKADGWHHRSDSLSSVVVLVGILVTKFFTEIWWMDSVLGMFCALAICYAAFQIMRESISKLLGEEPDQDLISKINSEIKGIYNNDLQVHHFHLHNYITQKEITFHIRLEKNMTIEKGHDIASNIESLIKEKFDMAATVHLEPLD*
Sample Types
Isolate
10.8%
Metagenome
89.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
62.2%
Unclassified
35.1%
Rhinotermitidae
2.7%
Taxonomy
Archaea
0
Bacteria
114
Eukaryota
0
Viruses
0
Unclassified
16
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125660 | Treponema sp. Emb289P3bin52 | Isolate | Unclassified |
| 2 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 3 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 4 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 5 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 6 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 7 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 8 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 9 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 10 | 2781125657 | Treponema sp. Emb289P3bin15 | Isolate | Unclassified |
| 11 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 12 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 13 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 14 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 15 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 16 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 17 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 18 | 2781125652 | Treponema sp. Cu122P5bin1 | Isolate | Unclassified |
| 19 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 20 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 21 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 22 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 23 | 2781125662 | Treponema sp. Emb289P3bin141 | Isolate | Unclassified |
| 24 | 2820027804 | Unclassified Spirochaetes Lab288P1bin105 | Isolate | Unclassified |
| 25 | 2781125659 | Treponema sp. Emb289P3bin114 | Isolate | Unclassified |
| 26 | 2819990093 | Unclassified Spirochaetes Cu122P1bin9 | Isolate | Unclassified |
| 27 | 2820272499 | Unclassified Firmicutes Th196P3bin18 | Isolate | Unclassified |
| 28 | 2781125631 | Treponema sp. Nt197P3bin89 | Isolate | Unclassified |
| 29 | 2781125663 | Treponema sp. Emb289P3bin135 | Isolate | Unclassified |
| 30 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 31 | 2781125664 | Treponema sp. Emb289P3bin139 | Isolate | Unclassified |
| 32 | 2820023741 | Unclassified Spirochaetes Lab288P3bin165 | Isolate | Unclassified |
| 33 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 34 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 35 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 36 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 37 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 38 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 39 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123356_10194413 | 3300010049 | Bacteria | 2063 |
| 2 | Ga0123356_10476548 | 3300010049 | Bacteria | 1400 |
| 3 | Ga0123356_10604986 | 3300010049 | Bacteria | 1261 |
| 4 | Ga0123356_10619586 | 3300010049 | Bacteria | 1248 |
| 5 | Ga0123353_10190440 | 3300010167 | Bacteria | 3238 |
| 6 | Ga0466694_126857 | 3300042594 | Bacteria | 2068 |
| 7 | Ga0466694_302080 | 3300042594 | Unclassified | 1564 |
| 8 | Ga0466701_096463 | 3300042598 | Bacteria | 1751 |
| 9 | Ga0466700_358223 | 3300042600 | Bacteria | 1525 |
| 10 | JGI24698J34947_10039214 | 3300002449 | Bacteria | 2453 |
| 11 | Ga0466712_002201 | 3300042614 | Bacteria | 13933 |
| 12 | Ga0466712_023972 | 3300042614 | Bacteria | 40905 |
| 13 | Ga0466697_067085 | 3300042611 | Bacteria | 1637 |
| 14 | Ga0466697_160959 | 3300042611 | Bacteria | 1252 |
| 15 | Ga0123356_10002033 | 3300010049 | Bacteria | 21839 |
| 16 | Ga0123356_10005099 | 3300010049 | Bacteria | 13460 |
| 17 | Ga0123356_10332333 | 3300010049 | Unclassified | 1637 |
| 18 | Ga0123356_10337101 | 3300010049 | Unclassified | 1627 |
| 19 | Ga0123356_10377424 | 3300010049 | Bacteria | 1549 |
| 20 | Ga0123353_10561430 | 3300010167 | Bacteria | 1643 |
| 21 | Ga0264413_100299 | 3300024493 | Bacteria | 10426 |
| 22 | Ga0264413_100302 | 3300024493 | Bacteria | 69754 |
| 23 | Ga0466731_190123 | 3300042622 | Bacteria | 1644 |
| 24 | Ga0466731_242257 | 3300042622 | Bacteria | 18511 |
| 25 | Ga0072940_1003958 | 3300005200 | Unclassified | 7324 |
| 26 | Ga0466712_006802 | 3300042614 | Unclassified | 2124 |
| 27 | Ga0123356_10002040 | 3300010049 | Bacteria | 21761 |
| 28 | Ga0123356_10003015 | 3300010049 | Bacteria | 17787 |
| 29 | Ga0123356_10014814 | 3300010049 | Bacteria | 7488 |
| 30 | Ga0123356_10787742 | 3300010049 | Bacteria | 1122 |
| 31 | Ga0123353_10797952 | 3300010167 | Bacteria | 1304 |
| 32 | Ga0466699_280575 | 3300042597 | Bacteria | 5017 |
| 33 | Ga0466699_326568 | 3300042597 | Unclassified | 2835 |
| 34 | Ga0466731_173346 | 3300042622 | Bacteria | 1481 |
| 35 | Ga0466721_351846 | 3300042608 | Bacteria | 2137 |
| 36 | JGI24698J34947_10004586 | 3300002449 | Bacteria | 7530 |
| 37 | JGI24698J34947_10024567 | 3300002449 | Bacteria | 3217 |
| 38 | JGI24697J35500_11267891 | 3300002507 | Bacteria | 3722 |
| 39 | Ga0072940_1060276 | 3300005200 | Bacteria | 3403 |
| 40 | Ga0466712_287832 | 3300042614 | Bacteria | 13115 |
| 41 | Ga0466718_012390 | 3300042617 | Bacteria | 6925 |
| 42 | Ga0466718_095355 | 3300042617 | Bacteria | 2044 |
| 43 | Ga0466697_245982 | 3300042611 | Bacteria | 2644 |
| 44 | Ga0123356_10000086 | 3300010049 | Bacteria | 97047 |
| 45 | Ga0123356_10010250 | 3300010049 | Bacteria | 9215 |
| 46 | Ga0466694_360919 | 3300042594 | Bacteria | 3087 |
| 47 | Ga0466695_290770 | 3300042595 | Bacteria | 97007 |
| 48 | Ga0466699_181876 | 3300042597 | Bacteria | 2260 |
| 49 | Ga0466714_152875 | 3300042603 | Unclassified | 1934 |
| 50 | Ga0466722_054949 | 3300042609 | Bacteria | 10991 |
| 51 | JGI24698J34947_10003778 | 3300002449 | Bacteria | 8253 |
| 52 | JGI24698J34947_10011263 | 3300002449 | Unclassified | 4910 |
| 53 | JGI24698J34947_10026107 | 3300002449 | Unclassified | 3106 |
| 54 | JGI24698J34947_10036222 | 3300002449 | Bacteria | 2570 |
| 55 | Ga0466712_019884 | 3300042614 | Bacteria | 29756 |
| 56 | Ga0466712_032347 | 3300042614 | Bacteria | 6044 |
| 57 | Ga0466712_117129 | 3300042614 | Bacteria | 17790 |
| 58 | Ga0466712_306220 | 3300042614 | Bacteria | 8213 |
| 59 | Ga0466718_149327 | 3300042617 | Bacteria | 1759 |
| 60 | Ga0123356_10021828 | 3300010049 | Bacteria | 6044 |
| 61 | Ga0123356_10051683 | 3300010049 | Bacteria | 3823 |
| 62 | Ga0123353_10123770 | 3300010167 | Bacteria | 4157 |
| 63 | Ga0466720_011510 | 3300042607 | Bacteria | 5261 |
| 64 | Ga0466721_221369 | 3300042608 | Bacteria | 7379 |
| 65 | JGI24698J34947_10002165 | 3300002449 | Bacteria | 10531 |
| 66 | JGI24698J34947_10018651 | 3300002449 | Bacteria | 3747 |
| 67 | JGI24698J34947_10031122 | 3300002449 | Bacteria | 2811 |
| 68 | Ga0072941_1008420 | 3300005201 | Bacteria | 21514 |
| 69 | Ga0466718_002660 | 3300042617 | Bacteria | 15942 |
| 70 | Ga0123356_10001465 | 3300010049 | Bacteria | 26010 |
| 71 | Ga0123356_10008085 | 3300010049 | Bacteria | 10473 |
| 72 | Ga0123356_10024379 | 3300010049 | Bacteria | 5694 |
| 73 | Ga0123353_10613830 | 3300010167 | Bacteria | 1550 |
| 74 | Ga0466699_134573 | 3300042597 | Bacteria | 4086 |
| 75 | Ga0466720_019995 | 3300042607 | Bacteria | 6432 |
| 76 | Ga0466720_100369 | 3300042607 | Bacteria | 11934 |
| 77 | JGI24698J34947_10144984 | 3300002449 | Bacteria | 994 |
| 78 | Ga0072941_1001597 | 3300005201 | Unclassified | 13390 |
| 79 | Ga0466712_056471 | 3300042614 | Bacteria | 2490 |
| 80 | Ga0466712_251848 | 3300042614 | Bacteria | 17089 |
| 81 | Ga0123356_10000073 | 3300010049 | Bacteria | 106706 |
| 82 | Ga0123356_10002956 | 3300010049 | Bacteria | 17962 |
| 83 | Ga0123356_10748534 | 3300010049 | Bacteria | 1147 |
| 84 | Ga0123353_10023944 | 3300010167 | Bacteria | 9255 |
| 85 | Ga0466656_024145 | 3300042550 | Bacteria | 1906 |
| 86 | Ga0466657_080847 | 3300042582 | Bacteria | 1043 |
| 87 | Ga0466731_145840 | 3300042622 | Bacteria | 1943 |
| 88 | Ga0466731_158064 | 3300042622 | Unclassified | 2798 |
| 89 | Ga0466717_304724 | 3300042604 | Bacteria | 3338 |
| 90 | Ga0466698_245679 | 3300042610 | Bacteria | 1429 |
| 91 | JGI24698J34947_10060236 | 3300002449 | Bacteria | 1873 |
| 92 | JGI24698J34947_10061062 | 3300002449 | Unclassified | 1857 |
| 93 | Ga0072941_1000785 | 3300005201 | Bacteria | 11320 |
| 94 | Ga0466718_065755 | 3300042617 | Unclassified | 14643 |
| 95 | Ga0466718_140013 | 3300042617 | Unclassified | 2903 |
| 96 | Ga0466718_161753 | 3300042617 | Bacteria | 1129 |
| 97 | Ga0466732_184891 | 3300042656 | Bacteria | 23606 |
| 98 | Ga0123356_10002672 | 3300010049 | Bacteria | 18934 |
| 99 | Ga0123356_10014550 | 3300010049 | Bacteria | 7563 |
| 100 | Ga0123356_10132689 | 3300010049 | Bacteria | 2443 |
| 101 | Ga0123353_10610775 | 3300010167 | Bacteria | 1556 |
| 102 | Ga0415639_054515 | 3300038395 | Bacteria | 3448 |
| 103 | Ga0466694_079165 | 3300042594 | Bacteria | 40053 |
| 104 | Ga0466694_177506 | 3300042594 | Unclassified | 1650 |
| 105 | Ga0466731_008682 | 3300042622 | Bacteria | 5077 |
| 106 | Ga0466722_019105 | 3300042609 | Bacteria | 4222 |
| 107 | JGI24698J34947_10000227 | 3300002449 | Bacteria | 23213 |
| 108 | JGI24698J34947_10001484 | 3300002449 | Bacteria | 12393 |
| 109 | JGI24698J34947_10001739 | 3300002449 | Bacteria | 11615 |
| 110 | JGI24698J34947_10002943 | 3300002449 | Bacteria | 9238 |
| 111 | JGI24698J34947_10010482 | 3300002449 | Bacteria | 5084 |
| 112 | JGI24698J34947_10078682 | 3300002449 | Bacteria | 1555 |
| 113 | Ga0466712_060478 | 3300042614 | Bacteria | 21849 |
| 114 | Ga0466712_203425 | 3300042614 | Bacteria | 8029 |
| 115 | Ga0466712_310229 | 3300042614 | Unclassified | 1201 |
| 116 | Ga0466718_078288 | 3300042617 | Bacteria | 22152 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.