Protein Family IF02645
Metagenome
Metatranscriptome
Isolate
192
Members
50
Samples
180
Scaffolds
302.21
Avg Length
Representative Sequence
- ID
- 3300010049|Ga0123356_10001874|Ga0123356_100018743
- Length
- 355 aa
- Sequence
- MNNEFTKTKEENVSYLILVIPALAIYLFVMAFPVLSSIALSFSTYPNSTTSIANRAEADRLREIQGGYVYAQWDQNLTQAERDNAVEMVQSLDAEIRRLTNVSMFNSENHGLGGIRAYREVLTDDLFYLALRNNILIVLISVFGQIPLGFFLAYILSRGLIKGTDFFQAMIYIPNVISAVIIGILFKNFFLGSQSVLLEIQRQFNPEAMYIPSGSDLYAVLAVILWMYTGIYMLIFLANLQKIDVSVIEASKIDGASEAQTLRYIILPALSGVIVTCAILAISGSLKSFDLIFVMTEGRPAHTTSVLSIYMYLKAFRGAPNYPVANAISTIMVVICFILIGITRFIEKRFSTGD*
Sample Types
Isolate
6.2%
Metagenome
93.2%
MAG
0.0%
Metatranscriptome
0.5%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
57.4%
Unclassified
25.5%
Kalotermitidae
8.5%
Rhinotermitidae
4.3%
Termopsidae
4.3%
Taxonomy
Archaea
1
Bacteria
177
Eukaryota
0
Viruses
0
Unclassified
14
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125648 | Treponema sp. Co191P3bin70 | Isolate | Unclassified |
| 2 | 2781125650 | Treponema sp. Co191P3bin64 | Isolate | Unclassified |
| 3 | 2781125664 | Treponema sp. Emb289P3bin139 | Isolate | Unclassified |
| 4 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 5 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 6 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 7 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 8 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 9 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 10 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 11 | 2781125696 | Treponema sp. Th196P4bin22 | Isolate | Unclassified |
| 12 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 13 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 14 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 15 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 16 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 17 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 18 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 19 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 20 | 3300021237 | Termite gut microbial communities from nest from French Guiana -FG16_15_2 mRNA SA | Metatranscriptome | |
| 21 | 2781125634 | Treponema sp. Co191P1bin45 | Isolate | Unclassified |
| 22 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 23 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 24 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 25 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 26 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 27 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 28 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 29 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 30 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 31 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 32 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 33 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 34 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 35 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 36 | 2781125647 | Treponema sp. Co191P3bin16 | Isolate | Unclassified |
| 37 | 2781125692 | Treponema sp. Th196P3bin31 | Isolate | Unclassified |
| 38 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 39 | 2781125636 | Treponema sp. Co191P1bin67 | Isolate | Unclassified |
| 40 | 2781125689 | Treponema sp. Mp193P4bin9 | Isolate | Unclassified |
| 41 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 42 | 2781125630 | Treponema sp. Nt197P3bin60 | Isolate | Unclassified |
| 43 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 44 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 45 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 46 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 47 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 48 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 49 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 50 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_396585 | 3300042656 | Bacteria | 2860 |
| 2 | Ga0466733_131762 | 3300042659 | Bacteria | 13323 |
| 3 | Ga0123356_10521078 | 3300010049 | Bacteria | 1347 |
| 4 | Ga0123353_10165468 | 3300010167 | Bacteria | 3516 |
| 5 | Ga0466694_348053 | 3300042594 | Bacteria | 1264 |
| 6 | Ga0466695_132722 | 3300042595 | Bacteria | 66949 |
| 7 | Ga0466717_199491 | 3300042604 | Bacteria | 1537 |
| 8 | Ga0466721_030608 | 3300042608 | Bacteria | 1506 |
| 9 | JGI24698J34947_10011800 | 3300002449 | Bacteria | 4799 |
| 10 | JGI24698J34947_10012005 | 3300002449 | Bacteria | 4756 |
| 11 | JGI24698J34947_10038401 | 3300002449 | Unclassified | 2484 |
| 12 | JGI24698J34947_10124073 | 3300002449 | Bacteria | 1115 |
| 13 | JGI24695J34938_10000242 | 3300002450 | Bacteria | 52426 |
| 14 | JGI24695J34938_10006649 | 3300002450 | Bacteria | 6896 |
| 15 | JGI24695J34938_10010206 | 3300002450 | Bacteria | 5167 |
| 16 | JGI24702J35022_10024968 | 3300002462 | Bacteria | 3227 |
| 17 | Ga0072941_1008020 | 3300005201 | Bacteria | 26013 |
| 18 | Ga0466712_097964 | 3300042614 | Bacteria | 12221 |
| 19 | Ga0466718_119268 | 3300042617 | Bacteria | 2860 |
| 20 | Ga0466702_289557 | 3300042635 | Bacteria | 1507 |
| 21 | Ga0466727_008384 | 3300042655 | Bacteria | 3062 |
| 22 | Ga0123355_10007096 | 3300009826 | Bacteria | 16706 |
| 23 | Ga0123356_10001006 | 3300010049 | Bacteria | 31315 |
| 24 | Ga0264413_111445 | 3300024493 | Bacteria | 14584 |
| 25 | Ga0466694_015101 | 3300042594 | Bacteria | 4771 |
| 26 | Ga0466694_026216 | 3300042594 | Bacteria | 44731 |
| 27 | Ga0466694_340331 | 3300042594 | Bacteria | 1522 |
| 28 | Ga0466695_080235 | 3300042595 | Bacteria | 4416 |
| 29 | Ga0466699_081095 | 3300042597 | Bacteria | 7613 |
| 30 | Ga0466699_175002 | 3300042597 | Bacteria | 9892 |
| 31 | Ga0466717_240523 | 3300042604 | Bacteria | 1621 |
| 32 | Ga0466720_115810 | 3300042607 | Bacteria | 4956 |
| 33 | Ga0466720_175220 | 3300042607 | Unclassified | 10339 |
| 34 | AustNasuHG_c1016683 | 3300000089 | Bacteria | 2451 |
| 35 | JGI24698J34947_10000916 | 3300002449 | Bacteria | 14958 |
| 36 | JGI24698J34947_10006776 | 3300002449 | Bacteria | 6293 |
| 37 | JGI24695J34938_10012089 | 3300002450 | Bacteria | 4601 |
| 38 | Ga0072940_1008489 | 3300005200 | Bacteria | 20120 |
| 39 | Ga0072941_1002224 | 3300005201 | Bacteria | 13116 |
| 40 | Ga0072941_1020810 | 3300005201 | Bacteria | 8497 |
| 41 | Ga0072941_1108529 | 3300005201 | Bacteria | 4104 |
| 42 | Ga0466712_007798 | 3300042614 | Bacteria | 50610 |
| 43 | Ga0466712_008285 | 3300042614 | Bacteria | 4313 |
| 44 | Ga0466712_205573 | 3300042614 | Bacteria | 2128 |
| 45 | Ga0466731_043852 | 3300042622 | Bacteria | 1468 |
| 46 | Ga0466731_133597 | 3300042622 | Bacteria | 2931 |
| 47 | Ga0466704_078378 | 3300042643 | Bacteria | 1113 |
| 48 | Ga0466732_064441 | 3300042656 | Bacteria | 1253 |
| 49 | Ga0123356_10026675 | 3300010049 | Bacteria | 5421 |
| 50 | Ga0123354_10286259 | 3300010882 | Bacteria | 1589 |
| 51 | Ga0466720_058663 | 3300042607 | Bacteria | 9225 |
| 52 | JGI24698J34947_10000427 | 3300002449 | Bacteria | 19318 |
| 53 | JGI24698J34947_10001773 | 3300002449 | Unclassified | 11508 |
| 54 | JGI24698J34947_10006437 | 3300002449 | Unclassified | 6445 |
| 55 | JGI24698J34947_10023869 | 3300002449 | Archaea | 3269 |
| 56 | JGI24698J34947_10088386 | 3300002449 | Bacteria | 1430 |
| 57 | JGI24695J34938_10094188 | 3300002450 | Bacteria | 1227 |
| 58 | JGI24702J35022_10003924 | 3300002462 | Bacteria | 8934 |
| 59 | JGI24697J35500_11257334 | 3300002507 | Bacteria | 2795 |
| 60 | Ga0072941_1186925 | 3300005201 | Bacteria | 2668 |
| 61 | Ga0466712_196999 | 3300042614 | Bacteria | 4913 |
| 62 | Ga0466718_038970 | 3300042617 | Bacteria | 2711 |
| 63 | Ga0466718_066298 | 3300042617 | Bacteria | 11016 |
| 64 | Ga0466726_146764 | 3300042619 | Bacteria | 5109 |
| 65 | Ga0466702_028183 | 3300042635 | Bacteria | 14973 |
| 66 | Ga0123356_10220554 | 3300010049 | Bacteria | 1952 |
| 67 | Ga0223675_1031935 | 3300021237 | Bacteria | 1062 |
| 68 | Ga0415639_012396 | 3300038395 | Bacteria | 22580 |
| 69 | Ga0466694_013253 | 3300042594 | Bacteria | 6336 |
| 70 | Ga0466694_055677 | 3300042594 | Bacteria | 1186 |
| 71 | Ga0466694_166314 | 3300042594 | Bacteria | 23774 |
| 72 | Ga0466699_009307 | 3300042597 | Bacteria | 35411 |
| 73 | Ga0466699_128341 | 3300042597 | Unclassified | 3823 |
| 74 | Ga0466699_186874 | 3300042597 | Bacteria | 2871 |
| 75 | Ga0466699_342211 | 3300042597 | Bacteria | 1266 |
| 76 | Ga0466720_049930 | 3300042607 | Bacteria | 8243 |
| 77 | Ga0466720_201711 | 3300042607 | Unclassified | 2033 |
| 78 | Ga0466698_247306 | 3300042610 | Bacteria | 1167 |
| 79 | AustNasuHG_c1020776 | 3300000089 | Bacteria | 2134 |
| 80 | JGI24698J34947_10011210 | 3300002449 | Bacteria | 4920 |
| 81 | JGI24695J34938_10000045 | 3300002450 | Bacteria | 92650 |
| 82 | JGI24695J34938_10000235 | 3300002450 | Bacteria | 52917 |
| 83 | JGI24702J35022_10001478 | 3300002462 | Bacteria | 14577 |
| 84 | Ga0466712_075690 | 3300042614 | Bacteria | 8376 |
| 85 | Ga0466712_185820 | 3300042614 | Unclassified | 5439 |
| 86 | Ga0466712_240636 | 3300042614 | Bacteria | 1867 |
| 87 | Ga0466712_253361 | 3300042614 | Bacteria | 30767 |
| 88 | Ga0123357_10024492 | 3300009784 | Unclassified | 8126 |
| 89 | Ga0123356_10050177 | 3300010049 | Unclassified | 3884 |
| 90 | Ga0123356_10140756 | 3300010049 | Bacteria | 2379 |
| 91 | Ga0264413_152307 | 3300024493 | Bacteria | 8965 |
| 92 | Ga0466694_355659 | 3300042594 | Bacteria | 1660 |
| 93 | Ga0466700_328624 | 3300042600 | Bacteria | 1455 |
| 94 | Ga0466720_060117 | 3300042607 | Bacteria | 13861 |
| 95 | Ga0466721_161591 | 3300042608 | Bacteria | 46073 |
| 96 | Ga0466721_221535 | 3300042608 | Bacteria | 2465 |
| 97 | Ga0466722_067610 | 3300042609 | Bacteria | 4546 |
| 98 | AustNasuHG_c1007277 | 3300000089 | Bacteria | 3941 |
| 99 | JGI24698J34947_10004930 | 3300002449 | Bacteria | 7314 |
| 100 | JGI24698J34947_10035003 | 3300002449 | Unclassified | 2624 |
| 101 | JGI24698J34947_10036648 | 3300002449 | Bacteria | 2553 |
| 102 | JGI24695J34938_10000133 | 3300002450 | Bacteria | 67517 |
| 103 | JGI24695J34938_10004501 | 3300002450 | Bacteria | 9120 |
| 104 | JGI24702J35022_10048991 | 3300002462 | Bacteria | 2249 |
| 105 | Ga0072941_1023534 | 3300005201 | Bacteria | 9896 |
| 106 | Ga0466712_038130 | 3300042614 | Bacteria | 20446 |
| 107 | Ga0466712_062588 | 3300042614 | Bacteria | 16377 |
| 108 | Ga0466711_168556 | 3300042615 | Bacteria | 55422 |
| 109 | Ga0466731_178748 | 3300042622 | Bacteria | 1041 |
| 110 | Ga0123356_10271650 | 3300010049 | Bacteria | 1785 |
| 111 | Ga0123354_10197918 | 3300010882 | Bacteria | 2222 |
| 112 | Ga0466691_001352 | 3300042593 | Bacteria | 12391 |
| 113 | Ga0466694_106808 | 3300042594 | Bacteria | 82814 |
| 114 | Ga0466699_012690 | 3300042597 | Bacteria | 2375 |
| 115 | Ga0466700_380245 | 3300042600 | Bacteria | 1914 |
| 116 | Ga0466720_008578 | 3300042607 | Bacteria | 37151 |
| 117 | Ga0466720_034100 | 3300042607 | Bacteria | 4481 |
| 118 | Ga0466698_168009 | 3300042610 | Bacteria | 41165 |
| 119 | Ga0466698_230152 | 3300042610 | Bacteria | 1911 |
| 120 | JGI24695J34938_10008767 | 3300002450 | Bacteria | 5727 |
| 121 | JGI24699J35502_11119610 | 3300002509 | Bacteria | 3183 |
| 122 | JGI24699J35502_11128640 | 3300002509 | Bacteria | 4464 |
| 123 | Ga0072941_1133873 | 3300005201 | Bacteria | 2226 |
| 124 | Ga0072941_1189219 | 3300005201 | Bacteria | 6108 |
| 125 | Ga0466712_202669 | 3300042614 | Bacteria | 9162 |
| 126 | Ga0466712_234226 | 3300042614 | Bacteria | 6919 |
| 127 | Ga0466718_135198 | 3300042617 | Bacteria | 11977 |
| 128 | Ga0466726_108101 | 3300042619 | Bacteria | 2189 |
| 129 | Ga0466731_315849 | 3300042622 | Bacteria | 2009 |
| 130 | Ga0466732_169328 | 3300042656 | Bacteria | 1671 |
| 131 | Ga0466732_330807 | 3300042656 | Bacteria | 1545 |
| 132 | Ga0466733_149869 | 3300042659 | Bacteria | 8387 |
| 133 | Ga0123356_10001443 | 3300010049 | Bacteria | 26277 |
| 134 | Ga0123356_10001874 | 3300010049 | Bacteria | 22787 |
| 135 | Ga0123356_10011142 | 3300010049 | Bacteria | 8777 |
| 136 | Ga0264413_101054 | 3300024493 | Bacteria | 8808 |
| 137 | Ga0466694_123668 | 3300042594 | Bacteria | 5234 |
| 138 | Ga0466720_020480 | 3300042607 | Bacteria | 4680 |
| 139 | AustNasuHG_c1001698 | 3300000089 | Bacteria | 7947 |
| 140 | AustNasuHG_c1037345 | 3300000089 | Unclassified | 1242 |
| 141 | JGI24698J34947_10009950 | 3300002449 | Unclassified | 5211 |
| 142 | JGI24698J34947_10011525 | 3300002449 | Unclassified | 4854 |
| 143 | JGI24698J34947_10015754 | 3300002449 | Bacteria | 4111 |
| 144 | JGI24698J34947_10015807 | 3300002449 | Bacteria | 4105 |
| 145 | JGI24702J35022_10004746 | 3300002462 | Bacteria | 8040 |
| 146 | Ga0072941_1000951 | 3300005201 | Bacteria | 23487 |
| 147 | Ga0072941_1043445 | 3300005201 | Bacteria | 9018 |
| 148 | Ga0466705_430412 | 3300042612 | Bacteria | 8024 |
| 149 | Ga0466712_120383 | 3300042614 | Unclassified | 2983 |
| 150 | Ga0466712_200412 | 3300042614 | Bacteria | 3639 |
| 151 | Ga0466712_209751 | 3300042614 | Bacteria | 8944 |
| 152 | Ga0466712_211517 | 3300042614 | Bacteria | 4322 |
| 153 | Ga0466712_225233 | 3300042614 | Bacteria | 4449 |
| 154 | Ga0466718_051125 | 3300042617 | Bacteria | 2584 |
| 155 | Ga0466718_112171 | 3300042617 | Bacteria | 2516 |
| 156 | Ga0466718_152015 | 3300042617 | Bacteria | 12980 |
| 157 | Ga0123353_10201166 | 3300010167 | Bacteria | 3134 |
| 158 | Ga0123353_10267239 | 3300010167 | Bacteria | 2638 |
| 159 | Ga0264413_102948 | 3300024493 | Bacteria | 3496 |
| 160 | Ga0264413_103164 | 3300024493 | Bacteria | 6986 |
| 161 | Ga0264413_103379 | 3300024493 | Bacteria | 13508 |
| 162 | Ga0264413_143338 | 3300024493 | Bacteria | 1985 |
| 163 | Ga0415639_139054 | 3300038395 | Bacteria | 4711 |
| 164 | Ga0466694_056937 | 3300042594 | Bacteria | 11086 |
| 165 | Ga0466694_068198 | 3300042594 | Bacteria | 4530 |
| 166 | Ga0466694_188429 | 3300042594 | Bacteria | 57168 |
| 167 | Ga0466720_066832 | 3300042607 | Bacteria | 7301 |
| 168 | Ga0466720_177676 | 3300042607 | Bacteria | 91443 |
| 169 | Ga0466720_226899 | 3300042607 | Bacteria | 15556 |
| 170 | Ga0466698_002202 | 3300042610 | Bacteria | 3162 |
| 171 | AustNasuHG_c1002727 | 3300000089 | Bacteria | 6369 |
| 172 | JGI24695J34938_10000174 | 3300002450 | Bacteria | 59663 |
| 173 | JGI24695J34938_10012453 | 3300002450 | Bacteria | 4505 |
| 174 | JGI24702J35022_10012262 | 3300002462 | Bacteria | 4769 |
| 175 | Ga0072941_1000564 | 3300005201 | Bacteria | 41647 |
| 176 | Ga0072941_1010746 | 3300005201 | Bacteria | 26854 |
| 177 | Ga0466712_236594 | 3300042614 | Bacteria | 2385 |
| 178 | Ga0466712_312230 | 3300042614 | Bacteria | 5222 |
| 179 | Ga0466718_054887 | 3300042617 | Bacteria | 4312 |
| 180 | Ga0466729_273871 | 3300042621 | Bacteria | 2015 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00528 | BPD_transp_1 | Binding-protein-dependent transport system inner membrane component | 146 | 351 | 0.92 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.