Protein Family IF02644
Metagenome
Isolate
117
Members
44
Samples
112
Scaffolds
158.5
Avg Length
Representative Sequence
- ID
- 3300010049|Ga0123356_10001693|Ga0123356_1000169311
- Length
- 177 aa
- Sequence
- MNNVTINSDGLTLPFWNDSARGYALKVLDEIKRDNWELSILFCNDKKIKSLNFQYRNKNEPTDILSFNLGETVKKGNKNIYLPGDIVISLDSLSKNAVYFQIPEDEELRRLLIHGILHLDGMDHKTLEKDEPMLKLQEKILDKLKNEHIIPNGSLLQVDDDKKSKNGRKISCGGKK*
Sample Types
Isolate
4.3%
Metagenome
95.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
45.2%
Kalotermitidae
28.6%
Unclassified
14.3%
Termopsidae
7.1%
Rhinotermitidae
4.8%
Taxonomy
Archaea
1
Bacteria
111
Eukaryota
0
Viruses
0
Unclassified
5
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125650 | Treponema sp. Co191P3bin64 | Isolate | Unclassified |
| 2 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 3 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 4 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 5 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 6 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 7 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 8 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 9 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 10 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 11 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 12 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 13 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 14 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 15 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 16 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 17 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 18 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 19 | 2781125659 | Treponema sp. Emb289P3bin114 | Isolate | Unclassified |
| 20 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 21 | 2781125634 | Treponema sp. Co191P1bin45 | Isolate | Unclassified |
| 22 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 23 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 24 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 25 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 26 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 27 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 28 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 29 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 30 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 31 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 32 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 33 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 34 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 35 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 36 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 37 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 38 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 39 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 40 | 2781125663 | Treponema sp. Emb289P3bin135 | Isolate | Unclassified |
| 41 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 42 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 43 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 44 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_060729 | 3300042612 | Bacteria | 3766 |
| 2 | Ga0466694_291943 | 3300042594 | Bacteria | 8665 |
| 3 | Ga0123356_10647153 | 3300010049 | Bacteria | 1224 |
| 4 | Ga0466707_135275 | 3300042601 | Bacteria | 1178 |
| 5 | Ga0466722_190855 | 3300042609 | Bacteria | 12564 |
| 6 | AustNasuHG_c1004855 | 3300000089 | Bacteria | 4812 |
| 7 | JGI24695J34938_10000007 | 3300002450 | Bacteria | 136740 |
| 8 | JGI24695J34938_10000845 | 3300002450 | Bacteria | 28392 |
| 9 | JGI24695J34938_10290800 | 3300002450 | Bacteria | 703 |
| 10 | Ga0466708_152059 | 3300042652 | Bacteria | 10876 |
| 11 | Ga0466727_076396 | 3300042655 | Bacteria | 6778 |
| 12 | Ga0466711_003790 | 3300042615 | Bacteria | 7700 |
| 13 | Ga0466728_019949 | 3300042620 | Bacteria | 5259 |
| 14 | Ga0466705_032048 | 3300042612 | Bacteria | 2295 |
| 15 | Ga0466732_386355 | 3300042656 | Bacteria | 1042 |
| 16 | Ga0415639_038796 | 3300038395 | Bacteria | 14366 |
| 17 | Ga0466694_178924 | 3300042594 | Bacteria | 9363 |
| 18 | Ga0123356_10001693 | 3300010049 | Bacteria | 24130 |
| 19 | Ga0123356_10592012 | 3300010049 | Bacteria | 1273 |
| 20 | Ga0123353_10067080 | 3300010167 | Bacteria | 5761 |
| 21 | Ga0466700_292084 | 3300042600 | Bacteria | 1475 |
| 22 | Ga0466707_047263 | 3300042601 | Bacteria | 18620 |
| 23 | Ga0072941_1040761 | 3300005201 | Bacteria | 8209 |
| 24 | Ga0466704_247802 | 3300042643 | Bacteria | 5063 |
| 25 | Ga0466712_003382 | 3300042614 | Bacteria | 2569 |
| 26 | Ga0466711_279255 | 3300042615 | Bacteria | 5812 |
| 27 | Ga0466718_017986 | 3300042617 | Unclassified | 14314 |
| 28 | Ga0466718_144179 | 3300042617 | Archaea | 1120 |
| 29 | Ga0415639_031420 | 3300038395 | Bacteria | 11292 |
| 30 | Ga0466693_197086 | 3300042592 | Bacteria | 15167 |
| 31 | Ga0123356_10002085 | 3300010049 | Bacteria | 21580 |
| 32 | Ga0123353_11823003 | 3300010167 | Bacteria | 755 |
| 33 | Ga0466716_404592 | 3300042605 | Bacteria | 1018 |
| 34 | Ga0466720_088215 | 3300042607 | Bacteria | 2362 |
| 35 | Ga0466721_022408 | 3300042608 | Bacteria | 34914 |
| 36 | Ga0466722_050060 | 3300042609 | Bacteria | 6792 |
| 37 | AustNasuHG_c1034956 | 3300000089 | Bacteria | 1333 |
| 38 | AustNasuHG_c1037225 | 3300000089 | Bacteria | 1247 |
| 39 | JGI24695J34938_10000063 | 3300002450 | Bacteria | 87942 |
| 40 | Ga0072941_1007233 | 3300005201 | Unclassified | 40154 |
| 41 | Ga0466735_042470 | 3300042624 | Bacteria | 3310 |
| 42 | Ga0466735_206182 | 3300042624 | Bacteria | 16936 |
| 43 | Ga0466703_300536 | 3300042636 | Bacteria | 1296 |
| 44 | Ga0466712_081449 | 3300042614 | Bacteria | 5707 |
| 45 | Ga0466715_285144 | 3300042616 | Bacteria | 11641 |
| 46 | Ga0466715_540587 | 3300042616 | Bacteria | 1776 |
| 47 | Ga0466718_006750 | 3300042617 | Bacteria | 7617 |
| 48 | Ga0466718_149198 | 3300042617 | Bacteria | 1994 |
| 49 | Ga0466705_081715 | 3300042612 | Bacteria | 9301 |
| 50 | Ga0415639_080491 | 3300038395 | Bacteria | 2403 |
| 51 | Ga0466696_221437 | 3300042596 | Bacteria | 1012 |
| 52 | Ga0123356_10086650 | 3300010049 | Bacteria | 2973 |
| 53 | Ga0466720_024075 | 3300042607 | Bacteria | 11745 |
| 54 | Ga0466720_057580 | 3300042607 | Bacteria | 1720 |
| 55 | Ga0466720_134623 | 3300042607 | Bacteria | 4113 |
| 56 | JGI24699J35502_10483800 | 3300002509 | Bacteria | 607 |
| 57 | Ga0074263_115386 | 3300005485 | Bacteria | 3517 |
| 58 | Ga0466730_074865 | 3300042625 | Bacteria | 1834 |
| 59 | Ga0466705_389024 | 3300042612 | Bacteria | 7110 |
| 60 | Ga0466712_206377 | 3300042614 | Bacteria | 6019 |
| 61 | Ga0466712_296161 | 3300042614 | Bacteria | 1510 |
| 62 | Ga0466718_018769 | 3300042617 | Bacteria | 8038 |
| 63 | Ga0466691_140817 | 3300042593 | Bacteria | 1841 |
| 64 | Ga0123356_10064385 | 3300010049 | Bacteria | 3428 |
| 65 | Ga0466720_139361 | 3300042607 | Bacteria | 5999 |
| 66 | Ga0466722_014313 | 3300042609 | Bacteria | 18073 |
| 67 | Ga0072941_1113971 | 3300005201 | Bacteria | 3500 |
| 68 | Ga0072941_1169639 | 3300005201 | Bacteria | 1504 |
| 69 | Ga0466711_471644 | 3300042615 | Bacteria | 39662 |
| 70 | Ga0466718_013384 | 3300042617 | Bacteria | 8927 |
| 71 | Ga0466718_134785 | 3300042617 | Bacteria | 4057 |
| 72 | Ga0264413_100300 | 3300024493 | Bacteria | 12096 |
| 73 | Ga0264413_100302 | 3300024493 | Bacteria | 69754 |
| 74 | Ga0466692_034584 | 3300042591 | Bacteria | 3245 |
| 75 | Ga0466694_107547 | 3300042594 | Bacteria | 58970 |
| 76 | Ga0123356_10021798 | 3300010049 | Bacteria | 6048 |
| 77 | JGI24698J34947_10001414 | 3300002449 | Bacteria | 12648 |
| 78 | JGI24695J34938_10005409 | 3300002450 | Bacteria | 7974 |
| 79 | Ga0072941_1029790 | 3300005201 | Unclassified | 7612 |
| 80 | Ga0072941_1098071 | 3300005201 | Unclassified | 1326 |
| 81 | Ga0466712_236106 | 3300042614 | Bacteria | 16720 |
| 82 | Ga0466712_238722 | 3300042614 | Bacteria | 6167 |
| 83 | Ga0466732_142729 | 3300042656 | Bacteria | 25250 |
| 84 | Ga0466694_079165 | 3300042594 | Bacteria | 40053 |
| 85 | Ga0466699_005857 | 3300042597 | Bacteria | 25238 |
| 86 | Ga0466707_343731 | 3300042601 | Bacteria | 5926 |
| 87 | Ga0466717_185909 | 3300042604 | Bacteria | 2846 |
| 88 | Ga0072941_1169638 | 3300005201 | Bacteria | 2815 |
| 89 | Ga0466735_044213 | 3300042624 | Bacteria | 25121 |
| 90 | Ga0466735_149400 | 3300042624 | Bacteria | 1459 |
| 91 | Ga0466712_030931 | 3300042614 | Unclassified | 33192 |
| 92 | Ga0466715_410633 | 3300042616 | Bacteria | 1696 |
| 93 | Ga0466715_418438 | 3300042616 | Bacteria | 4530 |
| 94 | Ga0466723_337651 | 3300042618 | Bacteria | 1171 |
| 95 | Ga0466726_302572 | 3300042619 | Bacteria | 1466 |
| 96 | Ga0264413_100301 | 3300024493 | Bacteria | 19762 |
| 97 | Ga0264413_135409 | 3300024493 | Bacteria | 1383 |
| 98 | Ga0466691_032418 | 3300042593 | Bacteria | 11220 |
| 99 | Ga0466696_032633 | 3300042596 | Bacteria | 26823 |
| 100 | Ga0123356_10004092 | 3300010049 | Bacteria | 15152 |
| 101 | JGI24698J34947_10001176 | 3300002449 | Bacteria | 13650 |
| 102 | JGI24698J34947_10036068 | 3300002449 | Bacteria | 2576 |
| 103 | JGI24695J34938_10000415 | 3300002450 | Bacteria | 41485 |
| 104 | JGI24695J34938_10000446 | 3300002450 | Bacteria | 39944 |
| 105 | Ga0072941_1007578 | 3300005201 | Bacteria | 12273 |
| 106 | Ga0072941_1533495 | 3300005201 | Bacteria | 830 |
| 107 | Ga0466703_277965 | 3300042636 | Bacteria | 4822 |
| 108 | Ga0466704_511957 | 3300042643 | Bacteria | 10131 |
| 109 | Ga0466709_415572 | 3300042648 | Bacteria | 11426 |
| 110 | Ga0466712_299516 | 3300042614 | Bacteria | 3755 |
| 111 | Ga0466711_242633 | 3300042615 | Bacteria | 9598 |
| 112 | Ga0466715_173704 | 3300042616 | Bacteria | 8097 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02130 | YbeY | Endoribonuclease YbeY | 32 | 144 | 0.92 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.