Protein Family IF02611
Metagenome
Isolate
180
Members
51
Samples
168
Scaffolds
329.08
Avg Length
Representative Sequence
- ID
- 3300010049|Ga0123356_10000145|Ga0123356_1000014545
- Length
- 336 aa
- Sequence
- MAGSLTYTAVETTKLSTSEVYGKTLVELGAKDKKVVALTADLAQSTKIGMFGDAYPDRFFNVGIAEQNMIGMASGMAKAGLIPFVSSFSVFTSLRCADQVHSDVCYQNLNVKIIATHGGTSFGQAGSTHHAIEDIAVMRSFVNMTVIIPADGIETANAVKMAHKTPGPFYIRINRGFDNVFYDKEDYGFEIGKAVKVCEGTDLTIIATGSCVFQAREASKILNASGIKARVLNIHTIKPIDKEAILSAVKDTRRIITVEDHSVIGGLGSAVAEVIAGSGKGCAFRMLGLQDKFSPIGLHEDLMAMHEIDANGIVKNAGELLKADFEADEDWSDDI*
Sample Types
Isolate
6.7%
Metagenome
93.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
35.3%
Kalotermitidae
27.5%
Unclassified
25.5%
Rhinotermitidae
5.9%
Termopsidae
5.9%
Taxonomy
Archaea
1
Bacteria
148
Eukaryota
0
Viruses
0
Unclassified
31
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125696 | Treponema sp. Th196P4bin22 | Isolate | Unclassified |
| 2 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 3 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 4 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 5 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 6 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 7 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 8 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 9 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 10 | 2820420508 | Unclassified Firmicutes Lab288P3bin68 | Isolate | Unclassified |
| 11 | 2820705605 | Unclassified Firmicutes Co191P1bin34 | Isolate | Unclassified |
| 12 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 13 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 14 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 15 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 16 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 17 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 18 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 19 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 20 | 2820240463 | Unclassified Firmicutes Th196P3bin85 | Isolate | Unclassified |
| 21 | 2820558799 | Unclassified Firmicutes Emb289P3bin74 | Isolate | Unclassified |
| 22 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 23 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 24 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 25 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 26 | 2781125694 | Treponema sp. Th196P3bin120 | Isolate | Unclassified |
| 27 | 2820391468 | Unclassified Firmicutes Nc150P3bin1 | Isolate | Unclassified |
| 28 | 2820429680 | Unclassified Firmicutes Lab288P3bin30 | Isolate | Unclassified |
| 29 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 30 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 31 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 32 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 33 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 34 | 2820584674 | Unclassified Firmicutes Emb289P1bin98 | Isolate | Unclassified |
| 35 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 36 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 37 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 38 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 39 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 40 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 41 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 42 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 43 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 44 | 2820474468 | Unclassified Firmicutes Lab288P1bin84 | Isolate | Unclassified |
| 45 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 46 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 47 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 48 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 49 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 50 | 2820657860 | Unclassified Firmicutes Co191P4bin15 | Isolate | Unclassified |
| 51 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466711_195788 | 3300042615 | Bacteria | 43179 |
| 2 | Ga0466715_518187 | 3300042616 | Unclassified | 1317 |
| 3 | Ga0466718_167457 | 3300042617 | Bacteria | 2490 |
| 4 | Ga0466723_334202 | 3300042618 | Unclassified | 13620 |
| 5 | Ga0466691_115443 | 3300042593 | Bacteria | 13963 |
| 6 | Ga0466709_258735 | 3300042648 | Bacteria | 25998 |
| 7 | Ga0123357_10159737 | 3300009784 | Bacteria | 2706 |
| 8 | Ga0123355_10245468 | 3300009826 | Bacteria | 2529 |
| 9 | Ga0123353_10000932 | 3300010167 | Bacteria | 35762 |
| 10 | Ga0123353_10018225 | 3300010167 | Bacteria | 10370 |
| 11 | Ga0466707_330292 | 3300042601 | Bacteria | 1061 |
| 12 | Ga0466716_100842 | 3300042605 | Bacteria | 3843 |
| 13 | Ga0072940_1032579 | 3300005200 | Unclassified | 2037 |
| 14 | Ga0072940_1084464 | 3300005200 | Unclassified | 2616 |
| 15 | Ga0072940_1161756 | 3300005200 | Bacteria | 2740 |
| 16 | Ga0466705_278583 | 3300042612 | Bacteria | 19732 |
| 17 | Ga0466715_151762 | 3300042616 | Bacteria | 3926 |
| 18 | Ga0466718_043086 | 3300042617 | Bacteria | 2672 |
| 19 | Ga0466723_014322 | 3300042618 | Unclassified | 1443 |
| 20 | Ga0466723_212058 | 3300042618 | Unclassified | 19629 |
| 21 | Ga0466726_017488 | 3300042619 | Bacteria | 13070 |
| 22 | Ga0466726_163522 | 3300042619 | Bacteria | 7138 |
| 23 | Ga0415639_009925 | 3300038395 | Bacteria | 63362 |
| 24 | Ga0466692_142303 | 3300042591 | Bacteria | 11124 |
| 25 | Ga0466693_010432 | 3300042592 | Bacteria | 1970 |
| 26 | Ga0466691_117939 | 3300042593 | Bacteria | 2161 |
| 27 | Ga0466703_142608 | 3300042636 | Bacteria | 3498 |
| 28 | Ga0466703_389486 | 3300042636 | Bacteria | 5771 |
| 29 | Ga0123355_10000500 | 3300009826 | Bacteria | 52249 |
| 30 | Ga0123356_10000145 | 3300010049 | Bacteria | 79704 |
| 31 | Ga0123356_10038918 | 3300010049 | Bacteria | 4431 |
| 32 | Ga0123353_10606280 | 3300010167 | Unclassified | 1563 |
| 33 | Ga0123353_10692083 | 3300010167 | Bacteria | 1433 |
| 34 | Ga0466707_120909 | 3300042601 | Bacteria | 1910 |
| 35 | Ga0466713_155128 | 3300042602 | Bacteria | 4770 |
| 36 | Ga0466716_401828 | 3300042605 | Bacteria | 4088 |
| 37 | Ga0466719_192399 | 3300042606 | Unclassified | 1275 |
| 38 | JGI24702J35022_10008569 | 3300002462 | Bacteria | 5786 |
| 39 | Ga0466712_005251 | 3300042614 | Bacteria | 6040 |
| 40 | Ga0466711_077314 | 3300042615 | Bacteria | 6016 |
| 41 | Ga0466711_099777 | 3300042615 | Bacteria | 9948 |
| 42 | Ga0466711_247869 | 3300042615 | Bacteria | 3078 |
| 43 | Ga0466711_299900 | 3300042615 | Bacteria | 1548 |
| 44 | Ga0466726_069480 | 3300042619 | Bacteria | 23044 |
| 45 | Ga0466726_307304 | 3300042619 | Bacteria | 2473 |
| 46 | Ga0466728_141558 | 3300042620 | Bacteria | 14934 |
| 47 | Ga0466690_390285 | 3300042590 | Bacteria | 2179 |
| 48 | Ga0466703_091497 | 3300042636 | Bacteria | 4821 |
| 49 | Ga0466704_028477 | 3300042643 | Bacteria | 15476 |
| 50 | Ga0466704_594897 | 3300042643 | Bacteria | 5615 |
| 51 | Ga0466709_193050 | 3300042648 | Bacteria | 5694 |
| 52 | Ga0123356_10189450 | 3300010049 | Bacteria | 2086 |
| 53 | Ga0123353_10067479 | 3300010167 | Bacteria | 5744 |
| 54 | Ga0123353_10415546 | 3300010167 | Bacteria | 1995 |
| 55 | Ga0466707_119926 | 3300042601 | Unclassified | 1429 |
| 56 | Ga0466716_311125 | 3300042605 | Bacteria | 3983 |
| 57 | Ga0466716_423473 | 3300042605 | Bacteria | 4511 |
| 58 | Ga0466719_052505 | 3300042606 | Bacteria | 2406 |
| 59 | Ga0466722_181203 | 3300042609 | Bacteria | 46889 |
| 60 | JGI24702J35022_10005412 | 3300002462 | Bacteria | 7473 |
| 61 | JGI24702J35022_10005445 | 3300002462 | Unclassified | 7435 |
| 62 | JGI24702J35022_10017837 | 3300002462 | Bacteria | 3876 |
| 63 | Ga0466726_339448 | 3300042619 | Bacteria | 1647 |
| 64 | Ga0415639_286136 | 3300038395 | Unclassified | 1294 |
| 65 | Ga0466690_232729 | 3300042590 | Bacteria | 4653 |
| 66 | Ga0466690_260356 | 3300042590 | Bacteria | 12886 |
| 67 | Ga0466692_180232 | 3300042591 | Bacteria | 17562 |
| 68 | Ga0466699_280942 | 3300042597 | Bacteria | 1094 |
| 69 | Ga0466704_227433 | 3300042643 | Bacteria | 15202 |
| 70 | Ga0466704_528528 | 3300042643 | Bacteria | 4968 |
| 71 | Ga0466708_204688 | 3300042652 | Unclassified | 3887 |
| 72 | Ga0123356_10143683 | 3300010049 | Bacteria | 2357 |
| 73 | Ga0123353_10118256 | 3300010167 | Bacteria | 4262 |
| 74 | Ga0466713_127766 | 3300042602 | Bacteria | 1427 |
| 75 | Ga0466716_067556 | 3300042605 | Bacteria | 9999 |
| 76 | Ga0466719_039352 | 3300042606 | Bacteria | 19876 |
| 77 | Ga0466698_241060 | 3300042610 | Bacteria | 1703 |
| 78 | JGI24702J35022_10006608 | 3300002462 | Bacteria | 6696 |
| 79 | JGI24702J35022_10156466 | 3300002462 | Unclassified | 1282 |
| 80 | JGI24702J35022_10173985 | 3300002462 | Unclassified | 1219 |
| 81 | Ga0466705_111372 | 3300042612 | Unclassified | 7889 |
| 82 | Ga0466690_009121 | 3300042590 | Bacteria | 15585 |
| 83 | Ga0466692_202197 | 3300042591 | Bacteria | 80474 |
| 84 | Ga0466691_117193 | 3300042593 | Unclassified | 2160 |
| 85 | Ga0466695_319233 | 3300042595 | Unclassified | 1584 |
| 86 | Ga0466696_010817 | 3300042596 | Bacteria | 8867 |
| 87 | Ga0466696_280988 | 3300042596 | Bacteria | 2500 |
| 88 | Ga0466703_109964 | 3300042636 | Bacteria | 17314 |
| 89 | Ga0466709_033731 | 3300042648 | Bacteria | 4631 |
| 90 | Ga0123355_10065420 | 3300009826 | Bacteria | 5856 |
| 91 | Ga0123355_10120817 | 3300009826 | Bacteria | 4065 |
| 92 | Ga0123353_10797320 | 3300010167 | Unclassified | 1305 |
| 93 | Ga0466707_015357 | 3300042601 | Bacteria | 1778 |
| 94 | Ga0466707_168334 | 3300042601 | Bacteria | 29939 |
| 95 | Ga0466716_063828 | 3300042605 | Bacteria | 8565 |
| 96 | Ga0466719_179129 | 3300042606 | Bacteria | 2912 |
| 97 | Ga0466722_107380 | 3300042609 | Archaea | 4538 |
| 98 | JGI24702J35022_10010554 | 3300002462 | Bacteria | 5158 |
| 99 | Ga0466723_085947 | 3300042618 | Bacteria | 4622 |
| 100 | Ga0466726_352549 | 3300042619 | Bacteria | 3337 |
| 101 | Ga0466728_187406 | 3300042620 | Unclassified | 1338 |
| 102 | Ga0466690_027213 | 3300042590 | Unclassified | 2223 |
| 103 | Ga0466690_290423 | 3300042590 | Unclassified | 2460 |
| 104 | Ga0466693_315197 | 3300042592 | Bacteria | 1468 |
| 105 | Ga0466691_186489 | 3300042593 | Unclassified | 3511 |
| 106 | Ga0466703_423403 | 3300042636 | Bacteria | 132694 |
| 107 | Ga0123356_10385654 | 3300010049 | Bacteria | 1535 |
| 108 | Ga0123353_10002690 | 3300010167 | Bacteria | 22148 |
| 109 | Ga0466713_135795 | 3300042602 | Bacteria | 36705 |
| 110 | Ga0466716_055043 | 3300042605 | Bacteria | 7503 |
| 111 | AustNasuHG_c1003344 | 3300000089 | Bacteria | 5789 |
| 112 | JGI24695J34938_10006985 | 3300002450 | Bacteria | 6691 |
| 113 | Ga0072940_1066062 | 3300005200 | Bacteria | 2625 |
| 114 | Ga0466705_493659 | 3300042612 | Bacteria | 27133 |
| 115 | Ga0466711_120404 | 3300042615 | Bacteria | 15432 |
| 116 | Ga0466715_136168 | 3300042616 | Bacteria | 23992 |
| 117 | Ga0466723_050995 | 3300042618 | Bacteria | 2831 |
| 118 | Ga0466726_343428 | 3300042619 | Bacteria | 6021 |
| 119 | Ga0466726_441548 | 3300042619 | Bacteria | 39085 |
| 120 | Ga0466691_128820 | 3300042593 | Bacteria | 5000 |
| 121 | Ga0466696_266448 | 3300042596 | Bacteria | 23351 |
| 122 | Ga0123356_10000331 | 3300010049 | Bacteria | 54509 |
| 123 | Ga0123353_10001824 | 3300010167 | Bacteria | 26202 |
| 124 | Ga0123353_10262731 | 3300010167 | Bacteria | 2665 |
| 125 | Ga0466700_255941 | 3300042600 | Bacteria | 2452 |
| 126 | Ga0466707_362377 | 3300042601 | Bacteria | 1290 |
| 127 | Ga0466713_082859 | 3300042602 | Bacteria | 3398 |
| 128 | Ga0466717_263080 | 3300042604 | Bacteria | 1587 |
| 129 | Ga0466719_373432 | 3300042606 | Bacteria | 15697 |
| 130 | Ga0466719_525657 | 3300042606 | Bacteria | 30104 |
| 131 | Ga0466722_084229 | 3300042609 | Bacteria | 96990 |
| 132 | Ga0466722_124768 | 3300042609 | Bacteria | 11230 |
| 133 | AustNasuHG_c1002853 | 3300000089 | Unclassified | 6238 |
| 134 | JGI24702J35022_10059845 | 3300002462 | Unclassified | 2035 |
| 135 | Ga0466705_179579 | 3300042612 | Bacteria | 4282 |
| 136 | Ga0466711_011926 | 3300042615 | Bacteria | 2651 |
| 137 | Ga0466711_179017 | 3300042615 | Bacteria | 1926 |
| 138 | Ga0466711_284996 | 3300042615 | Bacteria | 10578 |
| 139 | Ga0466711_324323 | 3300042615 | Bacteria | 4705 |
| 140 | Ga0466715_000382 | 3300042616 | Bacteria | 6068 |
| 141 | Ga0466718_009379 | 3300042617 | Bacteria | 2099 |
| 142 | Ga0466723_023716 | 3300042618 | Bacteria | 23982 |
| 143 | Ga0466723_029142 | 3300042618 | Bacteria | 3622 |
| 144 | Ga0466728_011064 | 3300042620 | Bacteria | 2837 |
| 145 | Ga0466728_262955 | 3300042620 | Bacteria | 2280 |
| 146 | Ga0466690_189918 | 3300042590 | Bacteria | 9315 |
| 147 | Ga0466690_195913 | 3300042590 | Unclassified | 27947 |
| 148 | Ga0466691_004379 | 3300042593 | Bacteria | 27826 |
| 149 | Ga0466696_189438 | 3300042596 | Unclassified | 24789 |
| 150 | Ga0466729_198082 | 3300042621 | Bacteria | 3375 |
| 151 | Ga0466731_277463 | 3300042622 | Unclassified | 1309 |
| 152 | Ga0466703_026803 | 3300042636 | Bacteria | 2121 |
| 153 | Ga0466704_516582 | 3300042643 | Bacteria | 3840 |
| 154 | Ga0466708_021866 | 3300042652 | Bacteria | 13432 |
| 155 | Ga0466708_067666 | 3300042652 | Unclassified | 8752 |
| 156 | Ga0466708_380137 | 3300042652 | Unclassified | 1375 |
| 157 | Ga0466727_139400 | 3300042655 | Unclassified | 1730 |
| 158 | Ga0466727_236378 | 3300042655 | Unclassified | 6530 |
| 159 | Ga0123356_10066204 | 3300010049 | Bacteria | 3381 |
| 160 | Ga0123353_10003749 | 3300010167 | Bacteria | 19343 |
| 161 | Ga0123353_10043080 | 3300010167 | Bacteria | 7148 |
| 162 | Ga0123353_10254411 | 3300010167 | Bacteria | 2717 |
| 163 | Ga0123353_10661413 | 3300010167 | Bacteria | 1476 |
| 164 | Ga0466707_007931 | 3300042601 | Bacteria | 3648 |
| 165 | Ga0466713_148635 | 3300042602 | Bacteria | 2378 |
| 166 | Ga0466719_498156 | 3300042606 | Bacteria | 69594 |
| 167 | JGI24702J35022_10010186 | 3300002462 | Bacteria | 5264 |
| 168 | Ga0068302_10257963 | 3300005071 | Bacteria | 1387 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.