Protein Family IF02388

Metagenome Isolate
120 Members
44 Samples
102 Scaffolds
220.54 Avg Length

🧬 Representative Sequence

ID
3300009826|Ga0123355_10028221|Ga0123355_100282214
Length
264 aa
Sequence
LPVIASEAKQSKPCVDTGLLRRFAPRNDSLSGFISSLRKCFFGGKNMAHILIVEDDRDINDLIARNLKLVGHTYQQVLTGPEAPAVAAESDFDLILLDVMLPGLDGFGVIQKIDRTPTIFITAKDGLEDRLTGLSLGADDYIVKPFEMLELLARIEAVLRRTQKNNTTFSLDGANIDMTTRIAKVQGQEVDLSPKEFDLLEVLIRNQNIALSREKLLELAWGYDYFGETRTVDNHIQKLRSKLGWEDRIKTIYKLGYRLEVKR*

📊 Sample Types

Isolate 15.0%
Metagenome 85.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 40.9%
Unclassified 38.6%
Kalotermitidae 13.6%
Termopsidae 4.5%
Rhinotermitidae 2.3%

🌳 Taxonomy

Archaea 0
Bacteria 111
Eukaryota 0
Viruses 0
Unclassified 9

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820671341 Unclassified Firmicutes Co191P3bin20 Isolate Unclassified
2 2821314491 Unclassified Actinobacteria Lab288P4bin49 Isolate Unclassified
3 2820495292 Unclassified Firmicutes Lab288P1bin59 Isolate Unclassified
4 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
5 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
6 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
7 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
8 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
9 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
10 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
11 2820630457 Unclassified Firmicutes Emb289P1bin119 Isolate Unclassified
12 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
13 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
14 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
15 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
16 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
17 2820375548 Unclassified Firmicutes Nt197P1bin8 Isolate Unclassified
18 2820472365 Unclassified Firmicutes Lab288P1bin87 Isolate Unclassified
19 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
20 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
21 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
22 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
23 2820364642 Unclassified Firmicutes Nt197P3bin107 Isolate Unclassified
24 2820431532 Unclassified Firmicutes Lab288P3bin230 Isolate Unclassified
25 2820673891 Unclassified Firmicutes Co191P3bin18 Isolate Unclassified
26 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
27 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
28 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
29 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
30 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
31 2820327087 Unclassified Firmicutes Nt197P3bin79 Isolate Unclassified
32 2820329821 Unclassified Firmicutes Nt197P3bin77 Isolate Unclassified
33 2820378768 Unclassified Firmicutes Nt197P1bin7 Isolate Unclassified
34 2820513949 Unclassified Firmicutes Lab288P1bin39 Isolate Unclassified
35 2820607737 Unclassified Firmicutes Emb289P1bin48 Isolate Unclassified
36 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
37 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
38 2820623020 Unclassified Firmicutes Emb289P1bin126 Isolate Unclassified
39 2820685979 Unclassified Firmicutes Co191P1bin81 Isolate Unclassified
40 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
41 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
42 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
43 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
44 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_008260 3300042659 Bacteria 1005
2 JGI24695J34938_10001667 3300002450 Bacteria 18437
3 Ga0123355_10067623 3300009826 Unclassified 5749
4 Ga0123355_10183508 3300009826 Bacteria 3100
5 Ga0123355_10227425 3300009826 Bacteria 2670
6 Ga0123355_10769287 3300009826 Bacteria 1083
7 Ga0123356_10272924 3300010049 Bacteria 1782
8 Ga0123353_10240172 3300010167 Bacteria 2815
9 Ga0123353_11251958 3300010167 Bacteria 968
10 Ga0466735_147196 3300042624 Bacteria 4816
11 Ga0466725_056742 3300042654 Bacteria 2061
12 Ga0466721_049871 3300042608 Bacteria 1790
13 Ga0466696_072392 3300042596 Bacteria 1389
14 Ga0466733_153954 3300042659 Bacteria 17068
15 Ga0123355_10000305 3300009826 Bacteria 63082
16 Ga0123355_10002842 3300009826 Bacteria 24602
17 Ga0123355_10030412 3300009826 Bacteria 8751
18 Ga0123355_10034104 3300009826 Bacteria 8267
19 Ga0123355_10055423 3300009826 Bacteria 6419
20 Ga0123355_10076398 3300009826 Bacteria 5357
21 Ga0123355_10084141 3300009826 Bacteria 5068
22 Ga0123355_10095131 3300009826 Bacteria 4710
23 Ga0123355_10460943 3300009826 Bacteria 1595
24 Ga0123355_10488698 3300009826 Bacteria 1526
25 Ga0123353_11413504 3300010167 Bacteria 893
26 Ga0123354_10139464 3300010882 Bacteria 3009
27 Ga0123354_10255559 3300010882 Bacteria 1763
28 Ga0466717_048698 3300042604 Unclassified 1072
29 Ga0466719_294874 3300042606 Bacteria 11089
30 Ga0466693_243268 3300042592 Bacteria 3723
31 Ga0466733_175873 3300042659 Bacteria 1036
32 JGI24695J34938_10007118 3300002450 Bacteria 6609
33 JGI24703J35330_11747317 3300002501 Bacteria 6553
34 Ga0466718_002674 3300042617 Bacteria 1783
35 Ga0466726_212907 3300042619 Bacteria 11190
36 Ga0123355_10001542 3300009826 Bacteria 32129
37 Ga0123355_10002055 3300009826 Bacteria 28435
38 Ga0123355_10004507 3300009826 Bacteria 20272
39 Ga0123353_10188924 3300010167 Unclassified 3254
40 Ga0466697_093337 3300042611 Bacteria 1223
41 Ga0466697_261179 3300042611 Bacteria 2588
42 Ga0466702_162091 3300042635 Bacteria 1309
43 Ga0466725_025002 3300042654 Bacteria 1031
44 Ga0466717_026248 3300042604 Bacteria 1134
45 Ga0466697_027287 3300042611 Bacteria 1205
46 Ga0466693_008046 3300042592 Bacteria 2966
47 Ga0466696_156646 3300042596 Bacteria 7547
48 JGI24705J35276_12235745 3300002504 Unclassified 6924
49 Ga0123355_10005610 3300009826 Bacteria 18410
50 Ga0123355_10150572 3300009826 Bacteria 3535
51 Ga0123355_10290490 3300009826 Bacteria 2244
52 Ga0123356_10530193 3300010049 Bacteria 1337
53 Ga0123353_10083097 3300010167 Bacteria 5152
54 Ga0123353_10413213 3300010167 Unclassified 2002
55 Ga0123354_10008133 3300010882 Unclassified 15919
56 Ga0466705_074940 3300042612 Bacteria 9319
57 Ga0466705_343056 3300042612 Bacteria 5171
58 Ga0466713_104272 3300042602 Bacteria 7478
59 Ga0466693_329018 3300042592 Bacteria 1467
60 Ga0466733_088523 3300042659 Bacteria 6844
61 Ga0123355_10001548 3300009826 Bacteria 32093
62 Ga0123355_10009772 3300009826 Bacteria 14628
63 Ga0123355_10009932 3300009826 Unclassified 14529
64 Ga0123355_10028221 3300009826 Bacteria 9075
65 Ga0123355_10146258 3300009826 Bacteria 3603
66 Ga0123355_10787824 3300009826 Unclassified 1064
67 Ga0123356_10266369 3300010049 Bacteria 1800
68 Ga0123354_10313262 3300010882 Bacteria 1461
69 Ga0466731_235519 3300042622 Bacteria 1636
70 Ga0466700_120237 3300042600 Bacteria 1670
71 Ga0466693_219645 3300042592 Unclassified 1488
72 Ga0466693_243870 3300042592 Bacteria 1354
73 JGI24695J34938_10002026 3300002450 Bacteria 16051
74 Ga0466715_025242 3300042616 Bacteria 19312
75 Ga0466723_321018 3300042618 Bacteria 2307
76 Ga0123355_10006303 3300009826 Bacteria 17537
77 Ga0123355_10037167 3300009826 Bacteria 7916
78 Ga0123355_10053297 3300009826 Bacteria 6558
79 Ga0123355_10323193 3300009826 Bacteria 2076
80 Ga0123356_10046078 3300010049 Bacteria 4056
81 Ga0123356_10634285 3300010049 Bacteria 1235
82 Ga0123356_11256603 3300010049 Bacteria 905
83 Ga0466735_164579 3300042624 Bacteria 1167
84 Ga0466701_046452 3300042598 Bacteria 32712
85 Ga0466693_436946 3300042592 Bacteria 3017
86 JGI24703J35330_11743195 3300002501 Bacteria 3848
87 Ga0466726_419980 3300042619 Bacteria 2902
88 Ga0123355_10228749 3300009826 Bacteria 2660
89 Ga0123353_10082373 3300010167 Bacteria 5175
90 Ga0123353_10481079 3300010167 Bacteria 1817
91 Ga0466721_396555 3300042608 Bacteria 3539
92 Ga0123355_10008157 3300009826 Bacteria 15809
93 Ga0123355_10075265 3300009826 Bacteria 5404
94 Ga0123355_10160946 3300009826 Bacteria 3382
95 Ga0123355_10224336 3300009826 Bacteria 2696
96 Ga0123355_10262772 3300009826 Bacteria 2411
97 Ga0123356_10333144 3300010049 Bacteria 1635
98 Ga0123353_10122688 3300010167 Bacteria 4176
99 Ga0466703_373778 3300042636 Bacteria 3249
100 Ga0466717_312285 3300042604 Bacteria 1263
101 Ga0466721_095990 3300042608 Bacteria 4540
102 Ga0466692_090704 3300042591 Bacteria 9100

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300009826 Ga0123355_10030412 Ga0123355_100304126 212
2 3300042598 Ga0466701_046452 Ga0466701_046452_29832_30479 215
3 3300042604 Ga0466717_312285 Ga0466717_312285_416_1063 215
4 3300042606 Ga0466719_294874 Ga0466719_294874_10288_10935 215
5 3300042608 Ga0466721_396555 Ga0466721_396555_478_1125 215
6 3300042619 Ga0466726_419980 Ga0466726_419980_721_1368 215
7 3300042624 Ga0466735_147196 Ga0466735_147196_3460_4107 215
8 iso_pr_bacteria 2820327087 2820328123 215
9 iso_pr_bacteria 2820364642 2820366419 215
10 iso_pr_bacteria 2821314491 2821315042 215
11 3300002504 JGI24705J35276_12235745 JGI24705J35276_122357452 216
12 3300010167 Ga0123353_10083097 Ga0123353_100830976 216
13 3300010167 Ga0123353_10122688 Ga0123353_101226883 216
14 3300010167 Ga0123353_10481079 Ga0123353_104810792 216
15 3300010167 Ga0123353_11251958 Ga0123353_112519581 216
16 3300010167 Ga0123353_11413504 Ga0123353_114135041 216
17 3300010882 Ga0123354_10008133 Ga0123354_100081336 216
18 3300010882 Ga0123354_10255559 Ga0123354_102555592 216
19 3300042592 Ga0466693_219645 Ga0466693_219645_323_973 216
20 3300042592 Ga0466693_243870 Ga0466693_243870_356_1006 216
21 3300042592 Ga0466693_436946 Ga0466693_436946_2250_2900 216
22 iso_pr_bacteria 2820673891 2820676056 216
23 iso_pr_bacteria 2820673891 2820676303 216
24 iso_pr_bacteria 2820673891 2820676577 216
25 iso_pr_bacteria 2820685979 2820688099 216
26 3300002450 JGI24695J34938_10002026 JGI24695J34938_1000202612 217
27 3300009826 Ga0123355_10002055 Ga0123355_1000205527 217
28 3300009826 Ga0123355_10009772 Ga0123355_100097728 217
29 3300009826 Ga0123355_10076398 Ga0123355_100763983 217
30 3300009826 Ga0123355_10084141 Ga0123355_100841415 217
31 3300009826 Ga0123355_10095131 Ga0123355_100951313 217
32 3300009826 Ga0123355_10183508 Ga0123355_101835082 217
33 3300010049 Ga0123356_10046078 Ga0123356_100460781 217
34 3300042592 Ga0466693_243268 Ga0466693_243268_95_748 217
35 3300042600 Ga0466700_120237 Ga0466700_120237_707_1402 217
36 3300042611 Ga0466697_027287 Ga0466697_027287_188_841 217
37 3300042622 Ga0466731_235519 Ga0466731_235519_708_1361 217
38 3300042654 Ga0466725_025002 Ga0466725_025002_144_797 217
39 3300042659 Ga0466733_088523 Ga0466733_088523_1580_2233 217
40 3300042659 Ga0466733_153954 Ga0466733_153954_6551_7204 217
41 iso_pr_bacteria 2820375548 2820376442 217
42 iso_pr_bacteria 2820495292 2820495766 217
43 iso_pr_bacteria 2820513949 2820515987 217
44 iso_pr_bacteria 2820607737 2820608829 217
45 iso_pr_bacteria 2820623020 2820624400 217
46 iso_pr_bacteria 2820630457 2820630895 217
47 iso_pr_bacteria 2820671341 2820671928 217
48 3300002450 JGI24695J34938_10001667 JGI24695J34938_1000166719 218
49 3300002450 JGI24695J34938_10007118 JGI24695J34938_100071185 218
50 3300002501 JGI24703J35330_11747317 JGI24703J35330_117473173 218
51 3300009826 Ga0123355_10000305 Ga0123355_1000030543 218
52 3300009826 Ga0123355_10001542 Ga0123355_100015422 218
53 3300009826 Ga0123355_10001548 Ga0123355_100015487 218
54 3300009826 Ga0123355_10004507 Ga0123355_1000450715 218
55 3300009826 Ga0123355_10005610 Ga0123355_100056109 218
56 3300009826 Ga0123355_10006303 Ga0123355_100063035 218
57 3300009826 Ga0123355_10008157 Ga0123355_1000815710 218
58 3300009826 Ga0123355_10009932 Ga0123355_100099327 218
59 3300009826 Ga0123355_10034104 Ga0123355_100341042 218
60 3300009826 Ga0123355_10053297 Ga0123355_100532972 218
61 3300009826 Ga0123355_10055423 Ga0123355_100554235 218
62 3300009826 Ga0123355_10067623 Ga0123355_100676232 218
63 3300009826 Ga0123355_10075265 Ga0123355_100752657 218
64 3300009826 Ga0123355_10150572 Ga0123355_101505723 218
65 3300009826 Ga0123355_10228749 Ga0123355_102287493 218
66 3300009826 Ga0123355_10262772 Ga0123355_102627722 218
67 3300009826 Ga0123355_10290490 Ga0123355_102904902 218
68 3300009826 Ga0123355_10460943 Ga0123355_104609431 218
69 3300009826 Ga0123355_10488698 Ga0123355_104886982 218
70 3300009826 Ga0123355_10769287 Ga0123355_107692872 218
71 3300009826 Ga0123355_10787824 Ga0123355_107878241 218
72 3300010049 Ga0123356_10266369 Ga0123356_102663692 218
73 3300010049 Ga0123356_10272924 Ga0123356_102729242 218
74 3300010049 Ga0123356_10530193 Ga0123356_105301931 218
75 3300010049 Ga0123356_10634285 Ga0123356_106342853 218
76 3300010167 Ga0123353_10082373 Ga0123353_100823733 218
77 iso_pr_bacteria 2820329821 2820331699 218
78 iso_pr_bacteria 2820378768 2820379379 218
79 iso_pr_bacteria 2820472365 2820473412 218
80 3300002501 JGI24703J35330_11743195 JGI24703J35330_117431952 219
81 3300042602 Ga0466713_104272 Ga0466713_104272_3396_4055 219
82 3300042611 Ga0466697_261179 Ga0466697_261179_150_809 219
83 iso_pr_bacteria 2820431532 2820432812 219
84 3300009826 Ga0123355_10227425 Ga0123355_102274252 220
85 3300009826 Ga0123355_10323193 Ga0123355_103231932 220
86 3300010049 Ga0123356_10333144 Ga0123356_103331441 220
87 3300010167 Ga0123353_10240172 Ga0123353_102401722 220
88 3300042604 Ga0466717_026248 Ga0466717_026248_234_896 220
89 3300042611 Ga0466697_093337 Ga0466697_093337_220_882 220
90 3300042635 Ga0466702_162091 Ga0466702_162091_536_1198 220
91 3300010049 Ga0123356_11256603 Ga0123356_112566031 221
92 3300010167 Ga0123353_10413213 Ga0123353_104132132 223
93 3300010882 Ga0123354_10139464 Ga0123354_101394641 223
94 3300042604 Ga0466717_048698 Ga0466717_048698_123_794 223
95 3300042608 Ga0466721_095990 Ga0466721_095990_1546_2226 226
96 3300042654 Ga0466725_056742 Ga0466725_056742_483_1163 226
97 3300009826 Ga0123355_10160946 Ga0123355_101609464 227
98 3300042596 Ga0466696_072392 Ga0466696_072392_283_966 227
99 3300042608 Ga0466721_049871 Ga0466721_049871_107_790 227
100 3300042612 Ga0466705_343056 Ga0466705_343056_4090_4773 227
101 3300042618 Ga0466723_321018 Ga0466723_321018_799_1482 227
102 3300042636 Ga0466703_373778 Ga0466703_373778_2324_3007 227
103 3300042659 Ga0466733_008260 Ga0466733_008260_247_930 227
104 3300042659 Ga0466733_175873 Ga0466733_175873_69_752 227
105 3300042616 Ga0466715_025242 Ga0466715_025242_224_910 228
106 3300042619 Ga0466726_212907 Ga0466726_212907_7271_7957 228
107 3300042624 Ga0466735_164579 Ga0466735_164579_444_1130 228
108 3300010167 Ga0123353_10188924 Ga0123353_101889242 230
109 3300010882 Ga0123354_10313262 Ga0123354_103132622 230
110 3300042592 Ga0466693_008046 Ga0466693_008046_1230_1925 231
111 3300042596 Ga0466696_156646 Ga0466696_156646_6200_6895 231
112 3300042612 Ga0466705_074940 Ga0466705_074940_6334_7029 231
113 3300009826 Ga0123355_10146258 Ga0123355_101462583 232
114 3300009826 Ga0123355_10002842 Ga0123355_1000284213 233
115 3300009826 Ga0123355_10037167 Ga0123355_100371672 233
116 3300042592 Ga0466693_329018 Ga0466693_329018_371_1081 236
117 3300042591 Ga0466692_090704 Ga0466692_090704_431_1144 237
118 3300009826 Ga0123355_10224336 Ga0123355_102243363 239
119 3300042617 Ga0466718_002674 Ga0466718_002674_949_1680 243
120 3300009826 Ga0123355_10028221 Ga0123355_100282214 264

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00072 Response_reg Response regulator receiver domain 50 156 0.98
PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal 187 259 0.98

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF00072 GO:0000160 phosphorelay signal transduction system BP

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.63 0.69 Medium

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.