Protein Family IF02285

Metagenome Isolate
123 Members
31 Samples
108 Scaffolds
201 Avg Length

🧬 Representative Sequence

ID
3300009826|Ga0123355_10000270|Ga0123355_1000027041
Length
237 aa
Sequence
MVFLQKFASHDENIHRKANLADFSHKALLYFRIMELIDMPKLFYQGHGSFRLTSNDGVVVYVDPFIGEGYDSPADIILVSHQHEDHNQTNLCAKKTQCTIISNVEALAGGKHNTFNLHGIEVEAVEAGYNQGHTPQDSVGFIVTMDGVKMYFSCDTSTTPQMKDFATKKLDYAFLCADGFYNMGLEEAAECAKLIGAKHNVPVHLKPGELFDRALAEQFNAPNRLIIEPGKDIELA*

📊 Sample Types

Isolate 12.2%
Metagenome 87.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 48.4%
Termitidae 45.2%
Kalotermitidae 3.2%
Termopsidae 3.2%

🌳 Taxonomy

Archaea 3
Bacteria 84
Eukaryota 0
Viruses 0
Unclassified 36

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820442516 Unclassified Firmicutes Lab288P3bin200 Isolate Unclassified
2 2820696217 Unclassified Firmicutes Co191P1bin66 Isolate Unclassified
3 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
4 2820873081 Unclassified Actinobacteria Lab288P1bin96 Isolate Unclassified
5 2820620956 Unclassified Firmicutes Emb289P1bin128 Isolate Unclassified
6 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
7 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
8 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
9 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
10 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
11 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
12 2820870086 Unclassified Actinobacteria Lab288P3bin107 Isolate Unclassified
13 2820676843 Unclassified Firmicutes Co191P3bin17 Isolate Unclassified
14 2820707375 Unclassified Firmicutes Co191P1bin31 Isolate Unclassified
15 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
16 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
17 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
18 2781125693 Treponema sp. Th196P3bin148 Isolate Unclassified
19 2820702360 Unclassified Firmicutes Co191P1bin4 Isolate Unclassified
20 2781125692 Treponema sp. Th196P3bin31 Isolate Unclassified
21 2820282995 Unclassified Firmicutes Th196P3bin147 Isolate Unclassified
22 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
23 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
24 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
25 2820231849 Unclassified Firmicutes Th196P4bin1 Isolate Unclassified
26 2820563109 Unclassified Firmicutes Emb289P3bin58 Isolate Unclassified
27 2820587002 Unclassified Firmicutes Emb289P1bin94 Isolate Unclassified
28 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
29 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
30 2820565217 Unclassified Firmicutes Emb289P3bin51 Isolate Unclassified
31 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466715_385685 3300042616 Unclassified 2257
2 Ga0123355_10717107 3300009826 Unclassified 1142
3 Ga0123356_10000050 3300010049 Bacteria 128418
4 Ga0123356_10011816 3300010049 Bacteria 8498
5 Ga0123356_10091345 3300010049 Bacteria 2902
6 Ga0123353_10543133 3300010167 Bacteria 1679
7 Ga0123353_10545229 3300010167 Bacteria 1675
8 Ga0415639_248663 3300038395 Unclassified 1545
9 JGI24702J35022_10000376 3300002462 Bacteria 26483
10 JGI24702J35022_10013996 3300002462 Bacteria 4433
11 Ga0123355_10000446 3300009826 Bacteria 54229
12 Ga0123356_10013011 3300010049 Unclassified 8049
13 Ga0123356_10078522 3300010049 Unclassified 3116
14 Ga0123353_10000081 3300010167 Bacteria 107026
15 Ga0123353_10004882 3300010167 Bacteria 17436
16 Ga0123353_10102811 3300010167 Bacteria 4605
17 Ga0123353_10111314 3300010167 Unclassified 4410
18 Ga0123353_10122842 3300010167 Bacteria 4174
19 Ga0123353_10192808 3300010167 Bacteria 3215
20 Ga0123353_10255982 3300010167 Unclassified 2707
21 Ga0123353_11209496 3300010167 Unclassified 991
22 Ga0123353_11217795 3300010167 Unclassified 986
23 Ga0123354_10408682 3300010882 Unclassified 1141
24 Ga0466725_165038 3300042654 Bacteria 1671
25 Ga0123355_10000270 3300009826 Bacteria 66244
26 Ga0123355_10131448 3300009826 Unclassified 3857
27 Ga0123355_10597789 3300009826 Bacteria 1311
28 Ga0123356_10041157 3300010049 Bacteria 4305
29 Ga0123353_10102203 3300010167 Bacteria 4620
30 Ga0123353_10150687 3300010167 Bacteria 3713
31 Ga0123353_10215632 3300010167 Bacteria 3007
32 Ga0123353_10235788 3300010167 Bacteria 2848
33 Ga0123353_10409428 3300010167 Archaea 2014
34 Ga0123353_10447983 3300010167 Unclassified 1902
35 Ga0123353_10791731 3300010167 Unclassified 1311
36 Ga0466714_043674 3300042603 Bacteria 35783
37 JGI24695J34938_10000024 3300002450 Bacteria 109661
38 JGI24702J35022_10283792 3300002462 Unclassified 973
39 Ga0123355_10026273 3300009826 Bacteria 9388
40 Ga0123355_10108006 3300009826 Bacteria 4357
41 Ga0123356_10010384 3300010049 Bacteria 9139
42 Ga0123356_10639561 3300010049 Bacteria 1230
43 Ga0123356_11222989 3300010049 Archaea 917
44 Ga0123353_10079212 3300010167 Bacteria 5281
45 Ga0123353_10128946 3300010167 Bacteria 4061
46 Ga0123353_10427993 3300010167 Unclassified 1959
47 Ga0123353_10917968 3300010167 Unclassified 1189
48 Ga0123354_10187867 3300010882 Bacteria 2328
49 Ga0123354_10226494 3300010882 Bacteria 1968
50 Ga0466694_233266 3300042594 Bacteria 6559
51 Ga0466700_149188 3300042600 Unclassified 1303
52 Ga0466725_347277 3300042654 Bacteria 2135
53 Ga0466725_372951 3300042654 Bacteria 6763
54 Ga0123355_10008185 3300009826 Bacteria 15792
55 Ga0123355_10725069 3300009826 Unclassified 1133
56 Ga0123355_10767083 3300009826 Bacteria 1085
57 Ga0123356_10060863 3300010049 Unclassified 3524
58 Ga0123356_10079080 3300010049 Unclassified 3105
59 Ga0123353_10229260 3300010167 Bacteria 2898
60 Ga0123353_10321706 3300010167 Bacteria 2347
61 Ga0123353_10363184 3300010167 Bacteria 2175
62 Ga0123353_10602203 3300010167 Unclassified 1570
63 Ga0123354_10002262 3300010882 Bacteria 25152
64 Ga0123354_10577905 3300010882 Unclassified 834
65 Ga0415639_013717 3300038395 Unclassified 6708
66 Ga0415639_027425 3300038395 Bacteria 4823
67 Ga0466710_431536 3300042613 Bacteria 1885
68 JGI24702J35022_10000037 3300002462 Bacteria 54731
69 JGI24702J35022_10004470 3300002462 Bacteria 8300
70 JGI24702J35022_10005146 3300002462 Bacteria 7672
71 JGI24702J35022_10038990 3300002462 Archaea 2535
72 Ga0466725_021658 3300042654 Bacteria 3494
73 Ga0123356_10003543 3300010049 Bacteria 16319
74 Ga0123356_10182378 3300010049 Bacteria 2122
75 Ga0123356_10257293 3300010049 Bacteria 1827
76 Ga0123353_10056231 3300010167 Bacteria 6297
77 Ga0123353_10422006 3300010167 Unclassified 1976
78 Ga0123353_10436192 3300010167 Bacteria 1934
79 Ga0123353_10809292 3300010167 Bacteria 1292
80 Ga0123353_11155305 3300010167 Bacteria 1021
81 Ga0123353_11250901 3300010167 Unclassified 969
82 Ga0123353_11871598 3300010167 Unclassified 742
83 Ga0466657_017134 3300042582 Unclassified 1197
84 JGI24695J34938_10040531 3300002450 Bacteria 2097
85 Ga0123355_10292476 3300009826 Unclassified 2233
86 Ga0123356_10024692 3300010049 Bacteria 5654
87 Ga0123356_10352203 3300010049 Bacteria 1596
88 Ga0123356_11377608 3300010049 Unclassified 866
89 Ga0123353_10049017 3300010167 Bacteria 6728
90 Ga0123353_10051171 3300010167 Bacteria 6590
91 Ga0123353_10112130 3300010167 Bacteria 4392
92 Ga0123353_10325787 3300010167 Unclassified 2329
93 Ga0123353_10643052 3300010167 Bacteria 1503
94 Ga0123353_10894303 3300010167 Bacteria 1210
95 Ga0123353_11506333 3300010167 Unclassified 856
96 Ga0466700_046475 3300042600 Bacteria 3229
97 JGI24705J35276_12238817 3300002504 Bacteria 232340
98 Ga0466727_312731 3300042655 Unclassified 1331
99 Ga0123355_10000151 3300009826 Bacteria 83578
100 Ga0123356_10011313 3300010049 Bacteria 8705
101 Ga0123356_10080526 3300010049 Bacteria 3079
102 Ga0123356_10728593 3300010049 Unclassified 1161
103 Ga0123356_10974632 3300010049 Unclassified 1018
104 Ga0123356_11415161 3300010049 Unclassified 855
105 Ga0123353_10561444 3300010167 Bacteria 1643
106 Ga0123353_10600301 3300010167 Bacteria 1573
107 Ga0123353_10835251 3300010167 Bacteria 1265
108 Ga0123353_10963831 3300010167 Unclassified 1152

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF13483 Lactamase_B_3 Beta-lactamase superfamily domain 42 204 0.88
PF12706 Lactamase_B_2 Beta-lactamase superfamily domain 104 204 0.84

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.