Protein Family IF02198

Metagenome Isolate
165 Members
42 Samples
153 Scaffolds
751.64 Avg Length

🧬 Representative Sequence

ID
3300009784|Ga0123357_10049215|Ga0123357_100492156
Length
814 aa
Sequence
MKIKNKNRRSISCFFPVVLFIVFSSFPVSGGIFFSGLDLSGDNQLLFHAGSGYSSVQEALFVTRLPAAAPEQGSAGFPAQQLTAFPEKMDLLENGRVLQIRNIFGAARLSLPAGLPMPIPGLPSFSGGTTGVSXRSGEMASSADGRWLLYLEPTSAAFGDLVMVDMHSGVKTQVASRLERPEKFFPASWSPDSRMFVYERDGKLYYYMAGTQAVPENEKIRFIGDGAINSIFWGRAGDFYYLSGSTLFRVRSAELITRALYADFLAIGTSVGTIPFEFDPGFDSFWVAPDGRSLLVSKGHRSLFYYPFDTEGQGGTSELPYLLLPRSCSGINVLWSNGGIVTVLVSIPGQTGTDARAWRLDLSGGKGAAFEPLPPPGTGSFALGSLSPDGSLALLWGDGGILLCDYANWKPLETLGSRPGTACLWAADDVIITGDDEKIEQIRLSLPRVNTVLHGAGPLGSTGSPVAGKNDQSGTPLAVVAQRDLVCLSRAPQAGFEEDSFRILAKSGDSWFVTDGKTPWTQINNPRLRSASLVSAQYRVFIERQGSGPYMNLPMIRNTASVGTFPLFPPPPGPRTSASVPAAESDVPYTPGTVFNRGQRNGAKEAALCFDLYDNDEGLPETLDALNRRGIKATFFLNGEFIRRHPLAVQNINAAGHEAASMFFVPLDFSDARYRVDSDFITRGLARNEDEFYRVTGKELALIWHSPWYMVTQDIVTAAAGAGYITTGRDVDPMDWVSRDDEKRLGRPQRSPSEMVDLIMGAVKPGSIIPVRLGFLPGGRKDYLFNRVNVLIDALLGEGYTLTTVSALVQHAK*

📊 Sample Types

Isolate 7.3%
Metagenome 92.7%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 33.3%
Unclassified 31.0%
Termitidae 23.8%
Rhinotermitidae 4.8%
Termopsidae 4.8%
Blaberidae 2.4%

🌳 Taxonomy

Archaea 2
Bacteria 158
Eukaryota 0
Viruses 0
Unclassified 5

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
2 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
3 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
4 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
5 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
6 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
7 2781125649 Treponema sp. Co191P3bin15 Isolate Unclassified
8 2781125661 Treponema sp. Emb289P3bin69 Isolate Unclassified
9 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
10 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
11 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
12 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
13 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
14 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
15 2772190975 Treponema sp. RmG30 Isolate Blaberidae
16 2781125637 Treponema sp. Co191P1bin9 Isolate Unclassified
17 2781125659 Treponema sp. Emb289P3bin114 Isolate Unclassified
18 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
19 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
20 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
21 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
22 2781125656 Treponema sp. Emb289P1bin65 Isolate Unclassified
23 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
24 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
25 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
26 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
27 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
28 2781125657 Treponema sp. Emb289P3bin15 Isolate Unclassified
29 2781125697 Treponema sp. Th196P4bin17 Isolate Unclassified
30 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
31 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
32 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
33 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
34 2781125648 Treponema sp. Co191P3bin70 Isolate Unclassified
35 2781125664 Treponema sp. Emb289P3bin139 Isolate Unclassified
36 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
37 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
38 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
39 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
40 2781125632 Treponema sp. Co191P1bin87 Isolate Unclassified
41 2781125662 Treponema sp. Emb289P3bin141 Isolate Unclassified
42 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466694_073495 3300042594 Bacteria 22298
2 Ga0466696_080074 3300042596 Bacteria 8789
3 Ga0466696_150561 3300042596 Bacteria 3284
4 Ga0466715_189446 3300042616 Bacteria 6264
5 Ga0466715_243993 3300042616 Bacteria 4276
6 Ga0466715_411550 3300042616 Bacteria 11651
7 Ga0466726_242939 3300042619 Bacteria 4534
8 Ga0466726_467127 3300042619 Bacteria 8094
9 Ga0466728_323303 3300042620 Bacteria 6319
10 Ga0466728_424593 3300042620 Bacteria 6196
11 Ga0466716_052145 3300042605 Bacteria 22754
12 Ga0466719_162484 3300042606 Bacteria 10183
13 Ga0466719_367100 3300042606 Bacteria 10557
14 Ga0466722_030168 3300042609 Bacteria 24541
15 Ga0123356_10000281 3300010049 Bacteria 58777
16 Ga0466703_161668 3300042636 Bacteria 18051
17 Ga0466703_327129 3300042636 Bacteria 12648
18 Ga0466704_042695 3300042643 Bacteria 12252
19 Ga0466704_244372 3300042643 Bacteria 14155
20 Ga0466709_063936 3300042648 Bacteria 7273
21 Ga0466709_121339 3300042648 Bacteria 19510
22 Ga0466708_114055 3300042652 Bacteria 7766
23 JGI24695J34938_10006984 3300002450 Bacteria 6692
24 Ga0466705_124233 3300042612 Bacteria 14569
25 Ga0466733_180521 3300042659 Bacteria 17102
26 Ga0415639_193781 3300038395 Bacteria 3778
27 Ga0466690_098314 3300042590 Bacteria 5178
28 Ga0466696_306420 3300042596 Bacteria 15892
29 Ga0466711_210537 3300042615 Bacteria 5603
30 Ga0466715_314541 3300042616 Bacteria 9915
31 Ga0466723_110263 3300042618 Bacteria 9880
32 Ga0466723_218636 3300042618 Bacteria 16915
33 Ga0466726_427243 3300042619 Bacteria 17847
34 Ga0466716_120450 3300042605 Bacteria 5060
35 Ga0466719_459331 3300042606 Bacteria 11143
36 Ga0123356_10007683 3300010049 Bacteria 10741
37 Ga0466703_031242 3300042636 Bacteria 12127
38 Ga0466704_316403 3300042643 Bacteria 3959
39 Ga0466704_325940 3300042643 Bacteria 3473
40 Ga0466704_424769 3300042643 Unclassified 12841
41 Ga0466708_138975 3300042652 Bacteria 14835
42 Ga0466708_365166 3300042652 Bacteria 2804
43 JGI24695J34938_10000272 3300002450 Bacteria 50568
44 JGI24695J34938_10007004 3300002450 Unclassified 6683
45 Ga0466705_165490 3300042612 Bacteria 12899
46 Ga0466691_002215 3300042593 Bacteria 9830
47 Ga0466696_270369 3300042596 Bacteria 5985
48 Ga0466723_233609 3300042618 Bacteria 9424
49 Ga0466723_272035 3300042618 Bacteria 8294
50 Ga0466728_011996 3300042620 Bacteria 16221
51 Ga0466728_141569 3300042620 Bacteria 4786
52 Ga0466719_037026 3300042606 Bacteria 14008
53 Ga0466719_099736 3300042606 Bacteria 10098
54 Ga0466719_110383 3300042606 Bacteria 2662
55 Ga0123356_10003414 3300010049 Bacteria 16656
56 Ga0466703_114043 3300042636 Bacteria 12568
57 Ga0466703_133260 3300042636 Bacteria 3720
58 Ga0466704_545871 3300042643 Bacteria 30505
59 Ga0466709_167461 3300042648 Bacteria 3036
60 Ga0466709_363239 3300042648 Bacteria 7027
61 Ga0466708_209929 3300042652 Bacteria 22287
62 JGI24695J34938_10000277 3300002450 Bacteria 50322
63 Ga0466733_171726 3300042659 Bacteria 10855
64 Ga0466692_016118 3300042591 Bacteria 25451
65 Ga0466696_154370 3300042596 Bacteria 10748
66 Ga0466711_230197 3300042615 Bacteria 15717
67 Ga0466715_100302 3300042616 Bacteria 14901
68 Ga0466723_162917 3300042618 Bacteria 35021
69 Ga0466719_019334 3300042606 Archaea 6698
70 Ga0466719_100250 3300042606 Bacteria 17752
71 Ga0466719_576750 3300042606 Bacteria 5261
72 Ga0466722_079374 3300042609 Bacteria 11583
73 Ga0123357_10049215 3300009784 Bacteria 5707
74 Ga0466703_220691 3300042636 Bacteria 4229
75 Ga0466703_391920 3300042636 Bacteria 11108
76 Ga0466704_311857 3300042643 Bacteria 3037
77 JGI24695J34938_10003658 3300002450 Bacteria 10539
78 Ga0466705_177886 3300042612 Bacteria 7538
79 Ga0466690_199836 3300042590 Bacteria 13330
80 Ga0466691_137710 3300042593 Bacteria 3791
81 Ga0466691_199481 3300042593 Bacteria 5027
82 Ga0466696_337617 3300042596 Bacteria 6086
83 Ga0466715_257997 3300042616 Bacteria 3020
84 Ga0466715_353993 3300042616 Bacteria 14235
85 Ga0466723_159008 3300042618 Bacteria 56322
86 Ga0466723_229569 3300042618 Bacteria 135891
87 Ga0466728_005733 3300042620 Bacteria 20067
88 Ga0466719_173747 3300042606 Bacteria 10027
89 Ga0123356_10000249 3300010049 Bacteria 61743
90 Ga0466704_183325 3300042643 Bacteria 8654
91 Ga0466704_363154 3300042643 Bacteria 5542
92 Ga0466704_416354 3300042643 Bacteria 10281
93 Ga0466704_454619 3300042643 Bacteria 9895
94 Ga0466705_022616 3300042612 Bacteria 11176
95 Ga0466705_110411 3300042612 Bacteria 3496
96 Ga0466733_003904 3300042659 Bacteria 41210
97 Ga0466691_008415 3300042593 Bacteria 11601
98 Ga0466691_051422 3300042593 Bacteria 10521
99 Ga0466691_190053 3300042593 Bacteria 5924
100 Ga0466696_142470 3300042596 Bacteria 16471
101 Ga0466696_262293 3300042596 Bacteria 8918
102 Ga0466705_421001 3300042612 Bacteria 2448
103 Ga0466711_158660 3300042615 Bacteria 36971
104 Ga0466715_121320 3300042616 Bacteria 10399
105 Ga0466726_145246 3300042619 Bacteria 3173
106 Ga0466728_255243 3300042620 Bacteria 7656
107 Ga0466713_059059 3300042602 Bacteria 7675
108 Ga0466716_240279 3300042605 Bacteria 3412
109 Ga0466716_302156 3300042605 Unclassified 4163
110 Ga0466722_060397 3300042609 Bacteria 28397
111 Ga0123357_10018779 3300009784 Bacteria 9199
112 Ga0466703_095476 3300042636 Bacteria 13766
113 Ga0466704_033267 3300042643 Bacteria 8914
114 Ga0466704_134411 3300042643 Bacteria 12309
115 Ga0466704_354677 3300042643 Bacteria 30303
116 Ga0466704_364093 3300042643 Bacteria 4196
117 Ga0466704_494170 3300042643 Bacteria 24558
118 Ga0068305_10428648 3300005083 Bacteria 7880
119 Ga0466705_224657 3300042612 Unclassified 7076
120 Ga0466696_218799 3300042596 Bacteria 9303
121 Ga0466705_402895 3300042612 Bacteria 3782
122 Ga0466705_463989 3300042612 Bacteria 17419
123 Ga0466711_366238 3300042615 Bacteria 31686
124 Ga0466715_397878 3300042616 Bacteria 19682
125 Ga0466723_056100 3300042618 Bacteria 7564
126 Ga0466716_147276 3300042605 Bacteria 16953
127 Ga0466719_051077 3300042606 Bacteria 6998
128 Ga0123355_10040252 3300009826 Unclassified 7607
129 Ga0123356_10005007 3300010049 Bacteria 13589
130 Ga0123356_10122064 3300010049 Bacteria 2536
131 Ga0123353_10074398 3300010167 Bacteria 5461
132 Ga0466703_342974 3300042636 Bacteria 17496
133 Ga0466708_051561 3300042652 Bacteria 14045
134 Ga0466727_061194 3300042655 Bacteria 25961
135 AustNasuHG_c1006816 3300000089 Archaea 4071
136 Ga0466705_012664 3300042612 Bacteria 7018
137 Ga0466705_074124 3300042612 Bacteria 9332
138 Ga0466705_114540 3300042612 Bacteria 11488
139 Ga0466705_253523 3300042612 Bacteria 5188
140 Ga0466690_043190 3300042590 Bacteria 8945
141 Ga0466696_187020 3300042596 Bacteria 14587
142 Ga0466715_468111 3300042616 Bacteria 3079
143 Ga0466715_519970 3300042616 Bacteria 5132
144 Ga0466723_362992 3300042618 Bacteria 2934
145 Ga0466728_008920 3300042620 Bacteria 17810
146 Ga0123356_10001369 3300010049 Bacteria 26973
147 Ga0123356_10034791 3300010049 Bacteria 4708
148 Ga0466704_397018 3300042643 Bacteria 2624
149 Ga0466709_104527 3300042648 Bacteria 11970
150 Ga0466708_250233 3300042652 Bacteria 19558
151 AustNasuHG_c1005573 3300000089 Bacteria 4501
152 JGI24695J34938_10010028 3300002450 Bacteria 5224
153 JGI24702J35022_10003976 3300002462 Bacteria 8869

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01522 Polysacc_deac_1 Polysaccharide deacetylase 600 724 0.84

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.