Protein Family IF02154
Metagenome
Isolate
117
Members
67
Samples
93
Scaffolds
144.68
Avg Length
Representative Sequence
- ID
- 3300009784|Ga0123357_10000738|Ga0123357_100007387
- Length
- 165 aa
- Sequence
- MVVQRASAARVVVDGVVVGSLPSPGLVVLVGVTHTDTPEIAAKLAAKLWQMRILAGEECPASDTTGTDADMAPRPWSSTAVSASDINAPILVISQFTLYADTRKGRRPSWSDAAPGPVAEPLVAAVVEALQALGAHVEQGVFGAHMTVELTNDGPVTIVLDSER*
Sample Types
Isolate
20.5%
Metagenome
79.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
25.4%
Termitidae
25.4%
Culicidae
10.2%
Kalotermitidae
8.5%
Tenebrionidae
6.8%
Rhinotermitidae
5.1%
Cambaridae
3.4%
Hydrophilidae
3.4%
Elmidae
1.7%
Pyralidae
1.7%
Apidae
1.7%
Armadillidiidae
1.7%
Termopsidae
1.7%
Thomisidae
1.7%
Hodotermitidae
1.7%
Taxonomy
Archaea
0
Bacteria
106
Eukaryota
0
Viruses
0
Unclassified
11
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820897376 | Unclassified Actinobacteria Lab288P1bin101 | Isolate | Unclassified |
| 2 | 2864899338 | Mycobacteroides chelonae S00154 | Isolate | Elmidae |
| 3 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 4 | 8030347546 | Propionimicrobium sp. PCR01-08-3 | Isolate | Tenebrionidae |
| 5 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 6 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 7 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 8 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 9 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 10 | 2884351759 | Cellulosimicrobium sp. BI34T | Isolate | Pyralidae |
| 11 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 12 | 3300012806 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG | Metagenome | |
| 13 | 3300012809 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG | Metagenome | |
| 14 | 2820838073 | Unclassified Actinobacteria Lab288P4bin27 | Isolate | Unclassified |
| 15 | 2931425734 | Nocardioides sp. J2M5 | Isolate | |
| 16 | 2931430189 | Tessaracoccus palaemonis J1M15 | Isolate | |
| 17 | 2518645556 | Nocardiopsis alba ATCC BAA-2165 | Isolate | Apidae |
| 18 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 19 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 20 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 21 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 22 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 23 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 24 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 25 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 26 | 3300012850 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG | Metagenome | Culicidae |
| 27 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 28 | 2820829137 | Unclassified Actinobacteria Nc150P5bin2 | Isolate | Unclassified |
| 29 | 2820911766 | Unclassified Actinobacteria Emb289P3bin96 | Isolate | Unclassified |
| 30 | 2915160415 | Leucobacter sp. cx-328 | Isolate | Cambaridae |
| 31 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 32 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 33 | 2681812870 | Oerskovia enterophila DFA-19 | Isolate | Unclassified |
| 34 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 35 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 36 | 2820863028 | Unclassified Actinobacteria Lab288P3bin164 | Isolate | Unclassified |
| 37 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 38 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 39 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 40 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 41 | 2820814774 | Unclassified Actinobacteria Nt197P3bin39 | Isolate | Unclassified |
| 42 | 2873589062 | Phycicoccus sp. HDW14 | Isolate | Hydrophilidae |
| 43 | 2915157839 | Leucobacter sp. cx-42 | Isolate | Cambaridae |
| 44 | 2504756063 | Isoptericola variabilis J5 | Isolate | Unclassified |
| 45 | 2630969010 | Friedmanniella luteola DSM 21741 | Isolate | Thomisidae |
| 46 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 47 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 48 | 3300056857 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) | Metagenome | Tenebrionidae |
| 49 | 8109397740 | Rhodococcus triatomae DSM 44892 | Isolate | Unclassified |
| 50 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 51 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 52 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 53 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 54 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 55 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 56 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 57 | 2820889385 | Unclassified Actinobacteria Lab288P1bin133 | Isolate | Unclassified |
| 58 | 2820926697 | Unclassified Actinobacteria Emb289P3bin125 | Isolate | Unclassified |
| 59 | 2873586004 | Sanguibacter sp. HDW7 | Isolate | Hydrophilidae |
| 60 | 2505679068 | Isoptericola variabilis 225 | Isolate | Unclassified |
| 61 | 2675903013 | Rhodococcus triatomae DSM 44892 | Isolate | Unclassified |
| 62 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 63 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 64 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 65 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 66 | 3300012818 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG | Metagenome | |
| 67 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0562379_0342 | 3300056790 | Bacteria | 113659 |
| 2 | Ga0123356_10000053 | 3300010049 | Bacteria | 124084 |
| 3 | Ga0123356_11180306 | 3300010049 | Bacteria | 932 |
| 4 | Ga0123354_10502052 | 3300010882 | Bacteria | 945 |
| 5 | Ga0466713_030641 | 3300042602 | Bacteria | 3581 |
| 6 | Ga0160447_104080 | 3300012849 | Bacteria | 4436 |
| 7 | Ga0160434_100021 | 3300012850 | Bacteria | 183425 |
| 8 | Ga0415639_027402 | 3300038395 | Bacteria | 1284 |
| 9 | Ga0072940_1071517 | 3300005200 | Bacteria | 5157 |
| 10 | Ga0466703_255574 | 3300042636 | Bacteria | 12668 |
| 11 | Ga0466727_131860 | 3300042655 | Bacteria | 2176 |
| 12 | Ga0123357_10015108 | 3300009784 | Bacteria | 10110 |
| 13 | Ga0123357_10554165 | 3300009784 | Bacteria | 914 |
| 14 | Ga0123354_10145839 | 3300010882 | Bacteria | 2897 |
| 15 | Ga0123354_10441224 | 3300010882 | Bacteria | 1063 |
| 16 | Ga0123354_10737930 | 3300010882 | Unclassified | 678 |
| 17 | Ga0160466_100017 | 3300012809 | Bacteria | 340691 |
| 18 | Ga0466719_179140 | 3300042606 | Bacteria | 8188 |
| 19 | Ga0160436_1011562 | 3300012861 | Unclassified | 1891 |
| 20 | AustNasuHG_c1000071 | 3300000089 | Bacteria | 28345 |
| 21 | Ga0072940_1365508 | 3300005200 | Bacteria | 2200 |
| 22 | Ga0123357_10000738 | 3300009784 | Bacteria | 32853 |
| 23 | Ga0466730_098086 | 3300042625 | Bacteria | 4171 |
| 24 | Ga0466725_235042 | 3300042654 | Bacteria | 2124 |
| 25 | Ga0466727_254824 | 3300042655 | Bacteria | 1144 |
| 26 | Ga0466718_126529 | 3300042617 | Bacteria | 6465 |
| 27 | Ga0562377_1756 | 3300056842 | Bacteria | 20139 |
| 28 | Ga0123356_10067302 | 3300010049 | Bacteria | 3355 |
| 29 | Ga0123356_10191950 | 3300010049 | Bacteria | 2074 |
| 30 | Ga0123353_10545498 | 3300010167 | Bacteria | 1674 |
| 31 | Ga0123354_10303503 | 3300010882 | Bacteria | 1505 |
| 32 | Ga0466706_151806 | 3300042599 | Bacteria | 1559 |
| 33 | Ga0466722_061584 | 3300042609 | Bacteria | 1724 |
| 34 | Ga0466698_232554 | 3300042610 | Bacteria | 1828 |
| 35 | Ga0160453_104083 | 3300012814 | Bacteria | 2794 |
| 36 | Ga0160446_102781 | 3300012835 | Unclassified | 2941 |
| 37 | Ga0160447_132583 | 3300012849 | Unclassified | 668 |
| 38 | Ga0466692_114549 | 3300042591 | Bacteria | 6083 |
| 39 | Ga0466729_204070 | 3300042621 | Bacteria | 1196 |
| 40 | Ga0466723_289764 | 3300042618 | Bacteria | 1027 |
| 41 | Ga0123357_10299239 | 3300009784 | Bacteria | 1628 |
| 42 | Ga0123357_10317239 | 3300009784 | Bacteria | 1546 |
| 43 | Ga0123357_10404553 | 3300009784 | Bacteria | 1238 |
| 44 | Ga0123356_10002336 | 3300010049 | Bacteria | 20375 |
| 45 | Ga0123356_10465155 | 3300010049 | Bacteria | 1415 |
| 46 | Ga0123356_11939846 | 3300010049 | Unclassified | 734 |
| 47 | Ga0123354_10009942 | 3300010882 | Bacteria | 14621 |
| 48 | Ga0123354_10039457 | 3300010882 | Bacteria | 7319 |
| 49 | Ga0466713_055644 | 3300042602 | Bacteria | 58992 |
| 50 | Ga0466720_094766 | 3300042607 | Bacteria | 1063 |
| 51 | Ga0160452_100003 | 3300012834 | Bacteria | 748778 |
| 52 | Ga0160434_108974 | 3300012850 | Unclassified | 1639 |
| 53 | Ga0160430_115297 | 3300012852 | Bacteria | 1164 |
| 54 | Ga0160448_105988 | 3300012854 | Unclassified | 3099 |
| 55 | Ga0466696_039670 | 3300042596 | Bacteria | 4394 |
| 56 | AustNasuHG_c1022526 | 3300000089 | Bacteria | 2022 |
| 57 | JGI24699J35502_11060554 | 3300002509 | Bacteria | 1736 |
| 58 | Ga0123357_10000137 | 3300009784 | Bacteria | 64068 |
| 59 | Ga0123353_10000327 | 3300010167 | Bacteria | 58829 |
| 60 | Ga0123353_10402361 | 3300010167 | Bacteria | 2037 |
| 61 | Ga0123353_10449575 | 3300010167 | Bacteria | 1897 |
| 62 | Ga0123353_10459285 | 3300010167 | Unclassified | 1872 |
| 63 | Ga0123354_10019766 | 3300010882 | Unclassified | 10577 |
| 64 | Ga0123354_10372177 | 3300010882 | Unclassified | 1245 |
| 65 | Ga0466713_121044 | 3300042602 | Bacteria | 17000 |
| 66 | Ga0160432_100175 | 3300012818 | Bacteria | 57245 |
| 67 | Ga0466693_243721 | 3300042592 | Bacteria | 130981 |
| 68 | Ga0562379_0440 | 3300056790 | Bacteria | 87979 |
| 69 | Ga0123356_10006972 | 3300010049 | Bacteria | 11342 |
| 70 | Ga0123354_10365318 | 3300010882 | Bacteria | 1266 |
| 71 | Ga0123354_10595100 | 3300010882 | Bacteria | 813 |
| 72 | Ga0160442_100094 | 3300012806 | Bacteria | 103917 |
| 73 | Ga0466713_011819 | 3300042602 | Bacteria | 6512 |
| 74 | Ga0160469_100347 | 3300012824 | Bacteria | 26130 |
| 75 | Ga0415639_019902 | 3300038395 | Bacteria | 4082 |
| 76 | Ga0466705_259401 | 3300042612 | Bacteria | 13556 |
| 77 | Ga0562379_0336 | 3300056790 | Bacteria | 114827 |
| 78 | Ga0562376_0002 | 3300056857 | Bacteria | 3502070 |
| 79 | Ga0123357_10371580 | 3300009784 | Bacteria | 1340 |
| 80 | Ga0123356_10081407 | 3300010049 | Bacteria | 3063 |
| 81 | Ga0123354_10638814 | 3300010882 | Bacteria | 765 |
| 82 | Ga0466707_136067 | 3300042601 | Bacteria | 1253 |
| 83 | Ga0466698_184347 | 3300042610 | Bacteria | 1912 |
| 84 | Ga0160459_102168 | 3300012831 | Bacteria | 3365 |
| 85 | Ga0160436_1033598 | 3300012861 | Bacteria | 857 |
| 86 | Ga0072940_1472660 | 3300005200 | Bacteria | 2768 |
| 87 | Ga0123356_10312269 | 3300010049 | Unclassified | 1682 |
| 88 | Ga0123356_10851333 | 3300010049 | Bacteria | 1083 |
| 89 | Ga0123354_10341396 | 3300010882 | Bacteria | 1349 |
| 90 | Ga0160446_103657 | 3300012835 | Bacteria | 2392 |
| 91 | Ga0466696_284240 | 3300042596 | Bacteria | 11400 |
| 92 | JGI24705J35276_12107014 | 3300002504 | Bacteria | 1033 |
| 93 | JGI24699J35502_11133672 | 3300002509 | Bacteria | 13352 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02580 | Tyr_Deacylase | D-Tyr-tRNA(Tyr) deacylase | 1 | 161 | 0.95 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.