Protein Family IF01907
Metagenome
Isolate
223
Members
169
Samples
120
Scaffolds
179.45
Avg Length
Representative Sequence
- ID
- 3300007192|Ga0103268_1000218|Ga0103268_100021810
- Length
- 189 aa
- Sequence
- MAELSTVARPYAEAVFASARDAADQAGPNGLSAWSDRLAQMAAVAAHPEVRQALADPRVAPAERIAIFTALIKSELPPGLPPSAHNFIALLVENDRLLLLPEIAAQFAAAKDRHEGVAVAEIASAFALDDAQVQELLAGLEQKFGGKLTARVTVDPALIGGVRVTVGDQVLDTSVRAQLTRLADTLAA*
Sample Types
Isolate
46.2%
Metagenome
53.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Coreidae
48.2%
Termitidae
13.9%
Unclassified
12.0%
Formicidae
9.0%
Kalotermitidae
7.2%
Termopsidae
2.4%
Rhinotermitidae
1.8%
Culicidae
1.2%
Largidae
1.2%
Berytidae
1.2%
Armadillidiidae
0.6%
Crambidae
0.6%
Alydidae
0.6%
Taxonomy
Archaea
0
Bacteria
215
Eukaryota
0
Viruses
0
Unclassified
8
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2891720358 | Azoarcus nasutitermitis CC-YHH838 | Isolate | Unclassified |
| 2 | 2820042117 | Unclassified Proteobacteria Th196P4bin58 | Isolate | Unclassified |
| 3 | 2820050117 | Unclassified Proteobacteria Th196P3bin129 | Isolate | Unclassified |
| 4 | 2820086750 | Unclassified Proteobacteria Lab288P3bin98 | Isolate | Unclassified |
| 5 | 2820132692 | Unclassified Proteobacteria Emb289P3bin76 | Isolate | Unclassified |
| 6 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 7 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 8 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 9 | 8025650824 | Caballeronia hypogeia LZ032 | Isolate | Coreidae |
| 10 | 8025671076 | Caballeronia cordobensis LZ034LL | Isolate | Coreidae |
| 11 | 8025735396 | Caballeronia zhejiangensis LZ016 | Isolate | Coreidae |
| 12 | 8102047609 | Caballeronia sp. GACF5 | Isolate | Coreidae |
| 13 | 8102074813 | Caballeronia sp. GAWG1-1 | Isolate | Coreidae |
| 14 | 8102081745 | Caballeronia sp. GAWG1-5s-s | Isolate | Coreidae |
| 15 | 8102117041 | Caballeronia sp. INML3 | Isolate | Coreidae |
| 16 | 8102131453 | Caballeronia sp. INML5 | Isolate | Coreidae |
| 17 | 8102138357 | Caballeronia sp. INSB1 | Isolate | Coreidae |
| 18 | 8102216467 | Caballeronia sp. LZ033 | Isolate | Coreidae |
| 19 | 8102230706 | Caballeronia sp. LZ035 | Isolate | Coreidae |
| 20 | 8102239244 | Caballeronia sp. LZ043 | Isolate | Coreidae |
| 21 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 22 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 23 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 24 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 25 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 26 | 2687453742 | Burkholderiales bacterium B_Cag20 | Isolate | Unclassified |
| 27 | 3300007083 | Ant gut microbial communities from Cephalotes persimilis, Brazil | Metagenome | Formicidae |
| 28 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 29 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 30 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 31 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 32 | 8023757577 | Caballeronia peredens LP006 | Isolate | Coreidae |
| 33 | 8023764196 | Caballeronia peredens LZ001 | Isolate | Coreidae |
| 34 | 8025678175 | Caballeronia hypogeia LZ043 | Isolate | Coreidae |
| 35 | 8025728939 | Caballeronia telluris LZ024 | Isolate | Coreidae |
| 36 | 8025747911 | Caballeronia peredens LZ003 | Isolate | Coreidae |
| 37 | 8069755105 | Caballeronia sp. LZ003 | Isolate | Coreidae |
| 38 | 8069775773 | Caballeronia sp. LZ062 | Isolate | Coreidae |
| 39 | 8101951471 | Caballeronia sp. AAUFL_F1_KS45 | Isolate | Coreidae |
| 40 | 8101974301 | Caballeronia sp. ASUFL_F2_KS49 | Isolate | Coreidae |
| 41 | 8101981714 | Caballeronia sp. ATUFL_F1_KS39 | Isolate | Coreidae |
| 42 | 8102020860 | Caballeronia sp. AZ10_KS36 | Isolate | Coreidae |
| 43 | 8102026984 | Caballeronia sp. AZ1_KS37 | Isolate | Coreidae |
| 44 | 8102067727 | Caballeronia sp. GAFFF3 | Isolate | Coreidae |
| 45 | 2855798354 | Achromobacter insolitus AR476-2 | Isolate | Crambidae |
| 46 | 2597489944 | Caballeronia insecticola RPE64 | Isolate | Alydidae |
| 47 | 2820152154 | Unclassified Proteobacteria Cu122P5bin47 | Isolate | Unclassified |
| 48 | 3003878002 | Paraburkholderia sp. PGU19 | Isolate | Largidae |
| 49 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 50 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 51 | 3300007139 | Ant gut microbial communities from Cephalotes pellans, Brazil | Metagenome | Formicidae |
| 52 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 53 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 54 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 55 | 8023752828 | Caballeronia grimmiae LZ062 | Isolate | Coreidae |
| 56 | 8024019580 | Caballeronia sp. Lep1P3 | Isolate | Coreidae |
| 57 | 8024044713 | Caballeronia sp. Sq4a | Isolate | Coreidae |
| 58 | 8069763219 | Caballeronia sp. LZ008 | Isolate | Coreidae |
| 59 | 8102001125 | Caballeronia sp. ATUFL_F2_KS9A | Isolate | Coreidae |
| 60 | 8102169119 | Caballeronia sp. LZ016 | Isolate | Coreidae |
| 61 | 8102181083 | Caballeronia sp. LZ025 | Isolate | Coreidae |
| 62 | 8102271933 | Caballeronia sp. NCF4 | Isolate | Coreidae |
| 63 | 2820047982 | Unclassified Proteobacteria Th196P3bin67 | Isolate | Unclassified |
| 64 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 65 | 3300002934 | Ant worker gut metagenome for colony PL005 | Metagenome | Formicidae |
| 66 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 67 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 68 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 69 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 70 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 71 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 72 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 73 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 74 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 75 | 8025716094 | Caballeronia zhejiangensis LZ028 | Isolate | Coreidae |
| 76 | 8101960468 | Caballeronia sp. AAUFL_F2_KS46 | Isolate | Coreidae |
| 77 | 8101988189 | Caballeronia sp. ATUFL_F1_KS4A | Isolate | Coreidae |
| 78 | 8102014801 | Caballeronia sp. ATUFL_M2_KS44 | Isolate | Coreidae |
| 79 | 8102060671 | Caballeronia sp. GAFFF2 | Isolate | Coreidae |
| 80 | 8102152052 | Caballeronia sp. LZ001 | Isolate | Coreidae |
| 81 | 8102208438 | Caballeronia sp. LZ032 | Isolate | Coreidae |
| 82 | 8102251710 | Caballeronia sp. LZ065 | Isolate | Coreidae |
| 83 | 8102279326 | Caballeronia sp. NCTM1 | Isolate | Coreidae |
| 84 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 85 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 86 | 2603880165 | Burkholderiales A1 | Isolate | Unclassified |
| 87 | 2603880170 | Burkholderiales A2 | Isolate | Unclassified |
| 88 | 2603880172 | Burkholderiales C | Isolate | Unclassified |
| 89 | 2820089333 | Unclassified Proteobacteria Lab288P3bin88 | Isolate | Unclassified |
| 90 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 91 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 92 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 93 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 94 | 8025658853 | Caballeronia temeraria LZ065 | Isolate | Coreidae |
| 95 | 8025708040 | Caballeronia jiangsuensis LZ029 | Isolate | Coreidae |
| 96 | 8069770227 | Caballeronia sp. LZ019 | Isolate | Coreidae |
| 97 | 8101994502 | Caballeronia sp. ATUFL_F2_KS42 | Isolate | Coreidae |
| 98 | 8102124461 | Caballeronia sp. INML3B | Isolate | Coreidae |
| 99 | 8102193924 | Caballeronia sp. LZ029 | Isolate | Coreidae |
| 100 | 8102312426 | Caballeronia sp. AAUFL_F1_KS47 | Isolate | Coreidae |
| 101 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 102 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 103 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 104 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 105 | 2820065746 | Unclassified Proteobacteria Nt197P3bin56 | Isolate | Unclassified |
| 106 | 2820084079 | Unclassified Proteobacteria Lab288P4bin103 | Isolate | Unclassified |
| 107 | 3003869270 | Paraburkholderia sp. PGU16 | Isolate | Largidae |
| 108 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 109 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 110 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 111 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 112 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 113 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 114 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 115 | 8023747282 | Caballeronia zhejiangensis LZ019 | Isolate | Coreidae |
| 116 | 8024025509 | Caballeronia grimmiae Lep1A1 | Isolate | Coreidae |
| 117 | 8024037630 | Caballeronia zhejiangensis A33_M4_a | Isolate | Coreidae |
| 118 | 8025685901 | Caballeronia fortuita LZ035 | Isolate | Coreidae |
| 119 | 8025723035 | Caballeronia grimmiae LZ025 | Isolate | Coreidae |
| 120 | 8025756023 | Caballeronia peredens LZ002 | Isolate | Coreidae |
| 121 | 8078130113 | Caballeronia sp. INDeC2 | Isolate | Coreidae |
| 122 | 8102054868 | Caballeronia sp. GAFFF1 | Isolate | Coreidae |
| 123 | 8102102351 | Caballeronia sp. INML1 | Isolate | Coreidae |
| 124 | 8102161003 | Caballeronia sp. LZ002 | Isolate | Coreidae |
| 125 | 8102174626 | Caballeronia sp. LZ024 | Isolate | Coreidae |
| 126 | 8102246966 | Caballeronia sp. LZ050 | Isolate | Coreidae |
| 127 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 128 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 129 | 2687453753 | Burkholderiales bacterium B_Cag25 | Isolate | Unclassified |
| 130 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 131 | 3300002938 | Larval gut metagenome for colony PL005 | Metagenome | Formicidae |
| 132 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 133 | 8024014383 | Caballeronia sp. SL2Y3 | Isolate | Berytidae |
| 134 | 8025740903 | Caballeronia zhejiangensis LZ008 | Isolate | Coreidae |
| 135 | 8069748016 | Caballeronia sp. LP003 | Isolate | Coreidae |
| 136 | 8102033761 | Caballeronia sp. AZ7_KS35 | Isolate | Coreidae |
| 137 | 8102094248 | Caballeronia sp. GaOx3 | Isolate | Coreidae |
| 138 | 8102109360 | Caballeronia sp. INML2 | Isolate | Coreidae |
| 139 | 8102145433 | Caballeronia sp. LP006 | Isolate | Coreidae |
| 140 | 8102186987 | Caballeronia sp. LZ028 | Isolate | Coreidae |
| 141 | 8102223607 | Caballeronia sp. LZ034LL | Isolate | Coreidae |
| 142 | 8102286609 | Caballeronia sp. NCTM5 | Isolate | Coreidae |
| 143 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 144 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 145 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 146 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 147 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 148 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 149 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 150 | 2820121232 | Unclassified Proteobacteria Emb289P4bin32 | Isolate | Unclassified |
| 151 | 2820123897 | Unclassified Proteobacteria Emb289P4bin18 | Isolate | Unclassified |
| 152 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 153 | 3300007141 | Ant gut microbial communities from Cephalotes maculatus, Brazil | Metagenome | Formicidae |
| 154 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 155 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 156 | 8023724303 | Caballeronia zhejiangensis LP003 | Isolate | Coreidae |
| 157 | 8024001094 | Caballeronia sp. TF1N1 | Isolate | Berytidae |
| 158 | 8025666332 | Caballeronia grimmiae LZ050 | Isolate | Coreidae |
| 159 | 8025694439 | Caballeronia cordobensis LZ033 | Isolate | Coreidae |
| 160 | 8025701579 | Caballeronia telluris LZ031 | Isolate | Coreidae |
| 161 | 8101967387 | Caballeronia sp. AAUFL_F3_KS11A | Isolate | Coreidae |
| 162 | 8102007614 | Caballeronia sp. ATUFL_M1_KS5A | Isolate | Coreidae |
| 163 | 8102041249 | Caballeronia sp. GACF4 | Isolate | Coreidae |
| 164 | 8102087471 | Caballeronia sp. GAWG2-1 | Isolate | Coreidae |
| 165 | 8102201977 | Caballeronia sp. LZ031 | Isolate | Coreidae |
| 166 | 8102264549 | Caballeronia sp. NCF2 | Isolate | Coreidae |
| 167 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 168 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 169 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0160457_1000405 | 3300012858 | Unclassified | 22189 |
| 2 | Ga0466657_005142 | 3300042582 | Bacteria | 5751 |
| 3 | JGI24705J35276_12140654 | 3300002504 | Unclassified | 1140 |
| 4 | Ga0072941_1734208 | 3300005201 | Bacteria | 801 |
| 5 | Ga0103261_1007382 | 3300007083 | Bacteria | 1571 |
| 6 | Ga0103264_1000943 | 3300007188 | Bacteria | 24253 |
| 7 | Ga0466734_059542 | 3300042623 | Bacteria | 5289 |
| 8 | Ga0466734_143966 | 3300042623 | Bacteria | 5120 |
| 9 | Ga0466734_173135 | 3300042623 | Bacteria | 3761 |
| 10 | Ga0466708_334281 | 3300042652 | Bacteria | 33858 |
| 11 | Ga0466725_115558 | 3300042654 | Bacteria | 1211 |
| 12 | Ga0466715_489248 | 3300042616 | Bacteria | 48521 |
| 13 | Ga0466719_318030 | 3300042606 | Bacteria | 16946 |
| 14 | Ga0466722_117171 | 3300042609 | Bacteria | 8925 |
| 15 | Ga0123353_12037254 | 3300010167 | Bacteria | 701 |
| 16 | Ga0123354_10221514 | 3300010882 | Bacteria | 2008 |
| 17 | Ga0466657_269966 | 3300042582 | Bacteria | 100925 |
| 18 | CVPL010W_10021137 | 3300002931 | Unclassified | 5323 |
| 19 | CVPL005L_10002296 | 3300002938 | Bacteria | 21930 |
| 20 | Ga0103265_1007061 | 3300007068 | Bacteria | 1499 |
| 21 | Ga0102739_1000307 | 3300007095 | Bacteria | 11194 |
| 22 | Ga0102737_1002402 | 3300007142 | Bacteria | 4658 |
| 23 | Ga0466703_038344 | 3300042636 | Bacteria | 10455 |
| 24 | Ga0466703_195519 | 3300042636 | Bacteria | 74513 |
| 25 | Ga0466724_33963 | 3300042649 | Bacteria | 1580 |
| 26 | Ga0123356_10573371 | 3300010049 | Bacteria | 1291 |
| 27 | Ga0466697_156548 | 3300042611 | Bacteria | 1212 |
| 28 | Ga0466697_252057 | 3300042611 | Bacteria | 3603 |
| 29 | Ga0466705_118406 | 3300042612 | Bacteria | 22374 |
| 30 | Ga0466733_040157 | 3300042659 | Bacteria | 27331 |
| 31 | Ga0160459_103166 | 3300012831 | Unclassified | 2431 |
| 32 | Ga0466657_343428 | 3300042582 | Bacteria | 4279 |
| 33 | Ga0466691_030876 | 3300042593 | Bacteria | 9288 |
| 34 | JGI24699J35502_10974689 | 3300002509 | Bacteria | 1249 |
| 35 | CVPL005W_1001625 | 3300002934 | Bacteria | 5568 |
| 36 | Ga0102740_1000232 | 3300007140 | Bacteria | 16196 |
| 37 | Ga0102737_1011350 | 3300007142 | Bacteria | 1478 |
| 38 | Ga0103264_1000737 | 3300007188 | Bacteria | 15353 |
| 39 | Ga0123357_10000050 | 3300009784 | Bacteria | 93540 |
| 40 | Ga0466704_026564 | 3300042643 | Bacteria | 41642 |
| 41 | Ga0466725_041394 | 3300042654 | Bacteria | 1426 |
| 42 | Ga0466710_118073 | 3300042613 | Bacteria | 32374 |
| 43 | Ga0466726_312095 | 3300042619 | Bacteria | 3512 |
| 44 | Ga0466700_428137 | 3300042600 | Bacteria | 1954 |
| 45 | Ga0466722_048156 | 3300042609 | Bacteria | 4557 |
| 46 | Ga0123353_10000519 | 3300010167 | Bacteria | 47639 |
| 47 | Ga0466692_091358 | 3300042591 | Bacteria | 11125 |
| 48 | Ga0466701_005790 | 3300042598 | Bacteria | 71240 |
| 49 | Ga0072941_1326033 | 3300005201 | Bacteria | 2098 |
| 50 | Ga0103266_1000558 | 3300007067 | Bacteria | 7453 |
| 51 | Ga0103260_1000534 | 3300007139 | Bacteria | 11157 |
| 52 | Ga0102738_1001390 | 3300007141 | Bacteria | 3770 |
| 53 | Ga0103264_1000411 | 3300007188 | Bacteria | 22810 |
| 54 | Ga0103264_1001079 | 3300007188 | Bacteria | 12144 |
| 55 | Ga0123357_10001794 | 3300009784 | Bacteria | 23240 |
| 56 | Ga0466708_088629 | 3300042652 | Bacteria | 6080 |
| 57 | Ga0466708_266701 | 3300042652 | Bacteria | 15517 |
| 58 | Ga0466710_201904 | 3300042613 | Bacteria | 119538 |
| 59 | Ga0466718_033841 | 3300042617 | Bacteria | 5173 |
| 60 | Ga0123353_10025510 | 3300010167 | Bacteria | 9007 |
| 61 | Ga0466697_166925 | 3300042611 | Bacteria | 1567 |
| 62 | Ga0466690_124436 | 3300042590 | Bacteria | 3305 |
| 63 | Ga0102734_1002104 | 3300007129 | Bacteria | 5319 |
| 64 | Ga0103260_1031882 | 3300007139 | Unclassified | 795 |
| 65 | Ga0466734_136333 | 3300042623 | Bacteria | 1993 |
| 66 | Ga0466730_079112 | 3300042625 | Bacteria | 1647 |
| 67 | Ga0466725_216650 | 3300042654 | Bacteria | 1325 |
| 68 | Ga0466723_004783 | 3300042618 | Bacteria | 50754 |
| 69 | Ga0466726_036682 | 3300042619 | Bacteria | 6343 |
| 70 | Ga0466717_205487 | 3300042604 | Unclassified | 1320 |
| 71 | Ga0466719_038470 | 3300042606 | Bacteria | 6808 |
| 72 | Ga0160441_100002 | 3300012825 | Bacteria | 856781 |
| 73 | Ga0466693_316890 | 3300042592 | Bacteria | 5155 |
| 74 | CVPL005W_1000361 | 3300002934 | Bacteria | 20202 |
| 75 | Ga0072941_1096165 | 3300005201 | Bacteria | 6990 |
| 76 | Ga0102736_1001599 | 3300007052 | Bacteria | 3898 |
| 77 | Ga0103264_1000547 | 3300007188 | Bacteria | 22281 |
| 78 | Ga0103268_1000218 | 3300007192 | Bacteria | 18974 |
| 79 | Ga0466735_073173 | 3300042624 | Bacteria | 4246 |
| 80 | Ga0466703_408887 | 3300042636 | Bacteria | 13876 |
| 81 | Ga0466709_073297 | 3300042648 | Bacteria | 46472 |
| 82 | Ga0466708_403743 | 3300042652 | Bacteria | 6295 |
| 83 | Ga0466727_036206 | 3300042655 | Bacteria | 41561 |
| 84 | Ga0466713_138497 | 3300042602 | Bacteria | 33519 |
| 85 | Ga0466717_044506 | 3300042604 | Unclassified | 3150 |
| 86 | Ga0466719_124770 | 3300042606 | Bacteria | 18525 |
| 87 | Ga0466694_107424 | 3300042594 | Bacteria | 3800 |
| 88 | CVPL010W_10005572 | 3300002931 | Bacteria | 13386 |
| 89 | CVPL010W_10011897 | 3300002931 | Bacteria | 17210 |
| 90 | Ga0068302_10159304 | 3300005071 | Bacteria | 5884 |
| 91 | Ga0068305_10452970 | 3300005083 | Bacteria | 11850 |
| 92 | Ga0102736_1003202 | 3300007052 | Bacteria | 4944 |
| 93 | Ga0102737_1002361 | 3300007142 | Bacteria | 4719 |
| 94 | Ga0102737_1003130 | 3300007142 | Bacteria | 3875 |
| 95 | Ga0466725_074169 | 3300042654 | Bacteria | 76060 |
| 96 | Ga0466727_259800 | 3300042655 | Bacteria | 8194 |
| 97 | Ga0466715_026089 | 3300042616 | Bacteria | 3374 |
| 98 | Ga0466718_102895 | 3300042617 | Bacteria | 8438 |
| 99 | Ga0466707_251230 | 3300042601 | Bacteria | 10685 |
| 100 | Ga0123356_10109662 | 3300010049 | Bacteria | 2664 |
| 101 | Ga0160464_100021 | 3300012805 | Bacteria | 235073 |
| 102 | Ga0466657_370980 | 3300042582 | Bacteria | 5925 |
| 103 | Ga0466696_350131 | 3300042596 | Bacteria | 3436 |
| 104 | JGI24702J35022_10011013 | 3300002462 | Bacteria | 5042 |
| 105 | CVPL010W_10000454 | 3300002931 | Bacteria | 42797 |
| 106 | CVPL010W_10005886 | 3300002931 | Bacteria | 13401 |
| 107 | Ga0103264_1000047 | 3300007188 | Bacteria | 127089 |
| 108 | Ga0103264_1001108 | 3300007188 | Bacteria | 12008 |
| 109 | Ga0466729_228872 | 3300042621 | Bacteria | 6116 |
| 110 | Ga0466702_373908 | 3300042635 | Bacteria | 8072 |
| 111 | Ga0466725_138046 | 3300042654 | Bacteria | 19951 |
| 112 | Ga0466710_141802 | 3300042613 | Bacteria | 2314 |
| 113 | Ga0466715_523004 | 3300042616 | Bacteria | 4734 |
| 114 | Ga0466726_237804 | 3300042619 | Bacteria | 14855 |
| 115 | Ga0466728_060718 | 3300042620 | Bacteria | 51497 |
| 116 | Ga0466707_267550 | 3300042601 | Bacteria | 3625 |
| 117 | Ga0466717_162124 | 3300042604 | Bacteria | 1176 |
| 118 | Ga0466721_059157 | 3300042608 | Bacteria | 2433 |
| 119 | Ga0123356_10013535 | 3300010049 | Unclassified | 7869 |
| 120 | Ga0160471_101702 | 3300012812 | Bacteria | 4099 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00213 | OSCP | ATP synthase delta (OSCP) subunit | 7 | 186 | 0.94 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.