Protein Family IF01837
Metagenome
Isolate
119
Members
69
Samples
109
Scaffolds
183.26
Avg Length
Representative Sequence
- ID
- 3300007153|Ga0104050_1030759|Ga0104050_10307597
- Length
- 208 aa
- Sequence
- SIVFCFIKTRRIIQATMKIYTKTGDRGTTALFGGTRVPKNHVRIEAYGTVDELNSYIGLIRDQEIPALEKQTLLAIQHHLFTVGAILATDPQKAVLKNGKERLNIPKITPDTLVLLENEIDRMEENLAPMTHFILPGGHTTVSFCHIARCVCRRSERLSVQLDQEEPVEPEVLMYLNRLSDYLFVLARKLTFDLQADEVKWIPEKLK*
Sample Types
Isolate
8.4%
Metagenome
91.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
29.0%
Kalotermitidae
22.6%
Formicidae
14.5%
Unclassified
4.8%
Culicidae
4.8%
Rhinotermitidae
3.2%
Drosophilidae
3.2%
Armadillidiidae
3.2%
Elmidae
3.2%
Termopsidae
3.2%
Daphniidae
1.6%
Tenebrionidae
1.6%
Passalidae
1.6%
Nephropidae
1.6%
Cambaridae
1.6%
Taxonomy
Archaea
0
Bacteria
114
Eukaryota
0
Viruses
0
Unclassified
5
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2894649344 | Allomuricauda alvinocaridis SCR12 | Isolate | Unclassified |
| 2 | 2904728850 | Flavobacterium sp. xlx-214 | Isolate | |
| 3 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 4 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 5 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 6 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 7 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 8 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 9 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 10 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 11 | 2811995047 | Flavobacterium succinicans DD5b | Isolate | Daphniidae |
| 12 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 13 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 14 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 15 | 2882250448 | Bizionia sp. APA-3 | Isolate | |
| 16 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 17 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 18 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 19 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 20 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 21 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 22 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 23 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 24 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 25 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 26 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 27 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 28 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 29 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 30 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 31 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 32 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 33 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 34 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 35 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 36 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 37 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 38 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 39 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 40 | 2899132286 | Myroides albus BIT-d1 | Isolate | Tenebrionidae |
| 41 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 42 | 3300012850 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG | Metagenome | Culicidae |
| 43 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 44 | 2864878056 | Flavobacterium notoginsengisoli S00128 | Isolate | Elmidae |
| 45 | 2864886855 | Flavobacterium nitrogenifigens S00142 | Isolate | Elmidae |
| 46 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 47 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 48 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 49 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 50 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 51 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 52 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 53 | 2838772460 | Aquimarina sp. I32.4 | Isolate | Nephropidae |
| 54 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 55 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 56 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 57 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 58 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 59 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 60 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 61 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 62 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 63 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 64 | 2958471994 | Flavobacterium sp. xlx-221 | Isolate | Cambaridae |
| 65 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 66 | 3300007733 | Gill chamber microbial communities of deep-sea hydrothermal vent shrimp from South Atlantic Ocean | Metagenome | |
| 67 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 68 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 69 | 2820737921 | Unclassified Bacteroidetes Th196P4bin18 | Isolate | Unclassified |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_149911 | 3300042656 | Bacteria | 4081 |
| 2 | Ga0466715_009739 | 3300042616 | Bacteria | 69251 |
| 3 | Ga0466723_009685 | 3300042618 | Bacteria | 37118 |
| 4 | Ga0466726_127228 | 3300042619 | Bacteria | 2133 |
| 5 | Ga0466713_153932 | 3300042602 | Bacteria | 2266 |
| 6 | Ga0466697_034546 | 3300042611 | Bacteria | 1186 |
| 7 | Ga0102735_1000778 | 3300007080 | Bacteria | 5951 |
| 8 | Ga0104019_1037544 | 3300007150 | Unclassified | 2436 |
| 9 | Ga0104019_1190119 | 3300007150 | Unclassified | 2800 |
| 10 | Ga0160453_100400 | 3300012814 | Bacteria | 36021 |
| 11 | Ga0160434_100055 | 3300012850 | Bacteria | 84316 |
| 12 | Ga0264413_145977 | 3300024493 | Bacteria | 1890 |
| 13 | Ga0466694_084880 | 3300042594 | Bacteria | 2204 |
| 14 | Ga0466734_016811 | 3300042623 | Bacteria | 1198 |
| 15 | Ga0466724_68743 | 3300042649 | Bacteria | 337166 |
| 16 | Ga0466729_193346 | 3300042621 | Bacteria | 2686 |
| 17 | Ga0466716_135899 | 3300042605 | Bacteria | 3019 |
| 18 | Ga0104050_1030759 | 3300007153 | Bacteria | 5933 |
| 19 | Ga0103267_1000824 | 3300007190 | Bacteria | 9224 |
| 20 | Ga0160443_100151 | 3300012848 | Bacteria | 100492 |
| 21 | Ga0160447_100001 | 3300012849 | Bacteria | 804378 |
| 22 | Ga0466690_130420 | 3300042590 | Bacteria | 14691 |
| 23 | Ga0466694_244098 | 3300042594 | Bacteria | 2483 |
| 24 | Ga0466696_209384 | 3300042596 | Bacteria | 9942 |
| 25 | Ga0466696_326118 | 3300042596 | Bacteria | 1954 |
| 26 | Ga0466703_212202 | 3300042636 | Bacteria | 1819 |
| 27 | Ga0466709_288746 | 3300042648 | Bacteria | 12492 |
| 28 | Ga0466708_008554 | 3300042652 | Bacteria | 4205 |
| 29 | Ga0466727_205449 | 3300042655 | Bacteria | 3622 |
| 30 | Ga0466705_264233 | 3300042612 | Bacteria | 10858 |
| 31 | Ga0466719_449753 | 3300042606 | Bacteria | 5259 |
| 32 | IMNBL1DRAFT_c0026113 | 3300000062 | Bacteria | 2226 |
| 33 | Ga0072941_1137215 | 3300005201 | Bacteria | 764 |
| 34 | Ga0102734_1000244 | 3300007129 | Unclassified | 16859 |
| 35 | Ga0102740_1000622 | 3300007140 | Unclassified | 9696 |
| 36 | Ga0105524_104201 | 3300007733 | Bacteria | 1332 |
| 37 | Ga0466696_079053 | 3300042596 | Bacteria | 6840 |
| 38 | Ga0123356_10081541 | 3300010049 | Bacteria | 3060 |
| 39 | Ga0123356_10805526 | 3300010049 | Bacteria | 1110 |
| 40 | Ga0466731_126371 | 3300042622 | Bacteria | 1785 |
| 41 | Ga0466702_404981 | 3300042635 | Bacteria | 1384 |
| 42 | Ga0466708_043204 | 3300042652 | Bacteria | 5332 |
| 43 | Ga0466705_089262 | 3300042612 | Bacteria | 7472 |
| 44 | Ga0466723_180089 | 3300042618 | Bacteria | 9242 |
| 45 | Ga0466728_014669 | 3300042620 | Bacteria | 2136 |
| 46 | Ga0466701_032541 | 3300042598 | Bacteria | 1189 |
| 47 | Ga0466701_077593 | 3300042598 | Bacteria | 3017 |
| 48 | Ga0103268_1000292 | 3300007192 | Bacteria | 40849 |
| 49 | Ga0264413_150852 | 3300024493 | Bacteria | 2234 |
| 50 | Ga0466692_169407 | 3300042591 | Bacteria | 2387 |
| 51 | Ga0466691_080629 | 3300042593 | Bacteria | 19438 |
| 52 | Ga0123353_10626234 | 3300010167 | Bacteria | 1530 |
| 53 | Ga0466704_488735 | 3300042643 | Bacteria | 37994 |
| 54 | Ga0466704_545058 | 3300042643 | Bacteria | 54255 |
| 55 | Ga0466733_037148 | 3300042659 | Bacteria | 5900 |
| 56 | Ga0466716_292482 | 3300042605 | Bacteria | 8582 |
| 57 | Ga0103267_1000248 | 3300007190 | Bacteria | 38664 |
| 58 | Ga0103267_1001023 | 3300007190 | Bacteria | 7013 |
| 59 | Ga0466657_300253 | 3300042582 | Bacteria | 17191 |
| 60 | Ga0466690_055599 | 3300042590 | Bacteria | 5316 |
| 61 | Ga0466699_439274 | 3300042597 | Bacteria | 1504 |
| 62 | Ga0123353_10895926 | 3300010167 | Bacteria | 1208 |
| 63 | Ga0466734_134293 | 3300042623 | Bacteria | 2550 |
| 64 | Ga0466723_189765 | 3300042618 | Bacteria | 20429 |
| 65 | Ga0466726_099639 | 3300042619 | Bacteria | 13212 |
| 66 | Ga0466726_418653 | 3300042619 | Bacteria | 12621 |
| 67 | Ga0466729_054902 | 3300042621 | Bacteria | 1423 |
| 68 | JGI24702J35022_10002349 | 3300002462 | Bacteria | 11571 |
| 69 | CVPL010W_10001300 | 3300002931 | Bacteria | 54229 |
| 70 | Ga0072941_1039444 | 3300005201 | Bacteria | 2707 |
| 71 | Ga0103267_1008053 | 3300007190 | Bacteria | 5783 |
| 72 | Ga0103268_1002996 | 3300007192 | Bacteria | 3602 |
| 73 | Ga0160472_100651 | 3300012839 | Bacteria | 17700 |
| 74 | Ga0160433_100052 | 3300012846 | Bacteria | 131130 |
| 75 | Ga0466692_110734 | 3300042591 | Bacteria | 12448 |
| 76 | Ga0123356_10144343 | 3300010049 | Bacteria | 2353 |
| 77 | Ga0123353_10110257 | 3300010167 | Bacteria | 4434 |
| 78 | Ga0466703_002684 | 3300042636 | Bacteria | 3870 |
| 79 | Ga0466709_389556 | 3300042648 | Bacteria | 6464 |
| 80 | Ga0466709_403996 | 3300042648 | Bacteria | 22459 |
| 81 | Ga0466725_018643 | 3300042654 | Bacteria | 1107 |
| 82 | Ga0466727_344741 | 3300042655 | Bacteria | 1998 |
| 83 | Ga0466710_441472 | 3300042613 | Bacteria | 1718 |
| 84 | Ga0466712_103899 | 3300042614 | Bacteria | 1273 |
| 85 | Ga0466728_040078 | 3300042620 | Bacteria | 4460 |
| 86 | Ga0466701_019932 | 3300042598 | Bacteria | 51949 |
| 87 | Ga0103265_1000041 | 3300007068 | Bacteria | 26367 |
| 88 | Ga0466708_210211 | 3300042652 | Bacteria | 9216 |
| 89 | Ga0466733_051929 | 3300042659 | Bacteria | 20603 |
| 90 | Ga0466711_024708 | 3300042615 | Bacteria | 11951 |
| 91 | Ga0466711_061877 | 3300042615 | Bacteria | 7189 |
| 92 | Ga0466726_139550 | 3300042619 | Bacteria | 14798 |
| 93 | Ga0466701_064830 | 3300042598 | Bacteria | 186218 |
| 94 | Ga0466701_101890 | 3300042598 | Bacteria | 9378 |
| 95 | JGI24702J35022_10077718 | 3300002462 | Bacteria | 1795 |
| 96 | Ga0102739_1000052 | 3300007095 | Bacteria | 32705 |
| 97 | Ga0102737_1000006 | 3300007142 | Bacteria | 73490 |
| 98 | Ga0103267_1000509 | 3300007190 | Bacteria | 11811 |
| 99 | Ga0160472_100061 | 3300012839 | Bacteria | 179642 |
| 100 | Ga0466657_387098 | 3300042582 | Bacteria | 1775 |
| 101 | Ga0466690_171977 | 3300042590 | Bacteria | 3690 |
| 102 | Ga0466690_225047 | 3300042590 | Bacteria | 3059 |
| 103 | Ga0466691_121114 | 3300042593 | Bacteria | 12423 |
| 104 | Ga0466699_091638 | 3300042597 | Unclassified | 1029 |
| 105 | Ga0123353_10791029 | 3300010167 | Bacteria | 1312 |
| 106 | Ga0123354_10238598 | 3300010882 | Bacteria | 1877 |
| 107 | Ga0160464_100233 | 3300012805 | Bacteria | 54312 |
| 108 | Ga0466734_025664 | 3300042623 | Bacteria | 4633 |
| 109 | Ga0466704_368649 | 3300042643 | Bacteria | 31781 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01923 | Cob_adeno_trans | Cobalamin adenosyltransferase | 19 | 189 | 0.93 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.