Protein Family IF01730
Metagenome
Isolate
319
Members
219
Samples
178
Scaffolds
368.16
Avg Length
Representative Sequence
- ID
- 3300007139|Ga0103260_1000041|Ga0103260_10000415
- Length
- 428 aa
- Sequence
- MGILVYRGCFPPPKRLFFTNLGLCLHSLNPQALTSRLDSRIISNRSPRHLQGTFVPTASSSTDLSCAFQITPHPQPRCPDERAKILAAPGFGQHFSDHMVRISWEKERLWHDAQVLPYGPISLNPAAAVLHYGQEVFEGLKAYRHADGSVWAFRPEANGQRLQRSAQRLALPPLPLELFIASLKQLITIDHDWVPSGGESSLYLRPFLIGDEAYLGVRASHKASYYLIASPAGAYFSGGIAPVSIWLADNYARAAGKGGTGAAKCGGNYAASLLPQMQAQAQGCSQVLFLDPVEGRYLEELGGMNVFLVYGQSNTLVTPALTGSILEGITRDSILQLARDRGMHTEERKILLSEWVDGVRSGEITEIFACGTAAVITPIGQLKGENLSVGEANAAPGPVSLSLRQALTDIQYGRAPDPHGWMQRLDA*
Sample Types
Isolate
44.2%
Metagenome
55.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
17.1%
Apidae
14.3%
Formicidae
12.4%
Drosophilidae
10.0%
Termitidae
8.6%
Culicidae
4.3%
Anthocoridae
4.3%
Scarabaeidae
3.8%
Tenebrionidae
3.8%
Armadillidiidae
3.8%
Kalotermitidae
3.8%
Cambaridae
2.9%
Elmidae
2.9%
Dytiscidae
1.4%
Hydrophilidae
1.4%
Termopsidae
1.0%
Rhinotermitidae
1.0%
Curculionidae
0.5%
Siricidae
0.5%
Hodotermitidae
0.5%
Cerambycidae
0.5%
Chironomidae
0.5%
Ixodidae
0.5%
Pyralidae
0.5%
Taxonomy
Archaea
0
Bacteria
302
Eukaryota
0
Viruses
0
Unclassified
17
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2617271320 | Acetobacter pomorum DmCS_004 | Isolate | Drosophilidae |
| 2 | 2836973655 | Gryllotalpicola protaetiae 2DFW10M-5 | Isolate | Scarabaeidae |
| 3 | 2854518031 | Acetobacter indonesiensis DmW_046 | Isolate | Drosophilidae |
| 4 | 2856671350 | Pseudonocardia sp. Ae356_Ps1 | Isolate | Formicidae |
| 5 | 2856947901 | Pseudonocardia sp. Ae168_Ps1 | Isolate | Formicidae |
| 6 | 2908241010 | Streptomyces sp. HF10 | Isolate | Termitidae |
| 7 | 2918390780 | Glutamicibacter protophormiae DSM 20168 | Isolate | Unclassified |
| 8 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 9 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 10 | 8030347546 | Propionimicrobium sp. PCR01-08-3 | Isolate | Tenebrionidae |
| 11 | 8069511479 | Arthrobacter ipsi IA7 | Isolate | Curculionidae |
| 12 | 8073626464 | Bartonella apis W8152 | Isolate | Apidae |
| 13 | 3006468911 | Streptomyces sp. RB17 | Isolate | Termitidae |
| 14 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 15 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 16 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 17 | 3300012828 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG | Metagenome | |
| 18 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 19 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 20 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 21 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 22 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 23 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 24 | 2523533511 | Streptomyces sp. Sv. ACTE SirexAA-E | Isolate | Siricidae |
| 25 | 2731957681 | Xylanimicrobium pachnodae JCM 13526, NBRC 107786 | Isolate | Scarabaeidae |
| 26 | 2751185858 | Bartonella apis BBC0122 | Isolate | Apidae |
| 27 | 2791354941 | Bombella intestini R-52487 | Isolate | Unclassified |
| 28 | 2818991320 | Klugiella xanthotipulae DSM 18031 | Isolate | Unclassified |
| 29 | 2820863028 | Unclassified Actinobacteria Lab288P3bin164 | Isolate | Unclassified |
| 30 | 2858084324 | Acetobacter sp. DsW_54 | Isolate | Drosophilidae |
| 31 | 2858119979 | Acetobacter malorum DsW_057 | Isolate | Drosophilidae |
| 32 | 2861945162 | Microbacterium sp. AR7-10 | Isolate | Culicidae |
| 33 | 2873617540 | Leucobacter insecticola HDW9B | Isolate | Dytiscidae |
| 34 | 2883683260 | Protaetiibacter larvae KACC 19322 | Isolate | Scarabaeidae |
| 35 | 2888667245 | Corynebacterium diphtheriae FRC0190 | Isolate | Unclassified |
| 36 | 2894900265 | Leucobacter sp. OLTLW20 | Isolate | Anthocoridae |
| 37 | 2894929448 | Leucobacter sp. OAMSW11 | Isolate | Anthocoridae |
| 38 | 2915168811 | Leucobacter sp. cx-169 | Isolate | Cambaridae |
| 39 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 40 | 8068941587 | Bartonella choladocola B10834H15 | Isolate | Apidae |
| 41 | 8073619611 | Bartonella apis B10834G6 | Isolate | Apidae |
| 42 | 3002678670 | Agromyces sp. G127AT | Isolate | Unclassified |
| 43 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 44 | 3300012798 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG | Metagenome | |
| 45 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 46 | 3300012815 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG | Metagenome | |
| 47 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 48 | 2504756063 | Isoptericola variabilis J5 | Isolate | Unclassified |
| 49 | 2648501322 | Streptomyces sp. SA3_actF | Isolate | Unclassified |
| 50 | 2834165886 | Saccharibacter sp. M18 | Isolate | Apidae |
| 51 | 2854576727 | Acetobacter okinawensis DsW_060 | Isolate | Drosophilidae |
| 52 | 2858089842 | Acetobacter tropicalis DmW_042 | Isolate | Drosophilidae |
| 53 | 2858110640 | Acetobacter indonesiensis DmL_051 | Isolate | Drosophilidae |
| 54 | 2859977607 | Pseudonocardia sp. Ae707_Ps1 | Isolate | Formicidae |
| 55 | 2873558832 | Propioniciclava coleopterorum HDW11 | Isolate | Hydrophilidae |
| 56 | 2873562573 | Thermomonas sp. HDW16 | Isolate | Hydrophilidae |
| 57 | 2884613238 | Agromyces intestinalis KACC 19306 | Isolate | Scarabaeidae |
| 58 | 2901819457 | Bombella sp. ESL0385 | Isolate | Apidae |
| 59 | 2915157839 | Leucobacter sp. cx-42 | Isolate | Cambaridae |
| 60 | 2820944107 | Unclassified Actinobacteria Cu122P5bin14 | Isolate | Unclassified |
| 61 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 62 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 63 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 64 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 65 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 66 | 3300056857 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) | Metagenome | Tenebrionidae |
| 67 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 68 | 8068946563 | Bartonella apihabitans M0187 | Isolate | Apidae |
| 69 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 70 | 3300002934 | Ant worker gut metagenome for colony PL005 | Metagenome | Formicidae |
| 71 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 72 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 73 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 74 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 75 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 76 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 77 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 78 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 79 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 80 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 81 | 2751185679 | Parasaccharibacter apium G7_7_3c | Isolate | Apidae |
| 82 | 2816332114 | Microbacterium saperdae DSM 20169 | Isolate | Unclassified |
| 83 | 2820825283 | Unclassified Actinobacteria Nt197P3bin111 | Isolate | Unclassified |
| 84 | 2820894511 | Unclassified Actinobacteria Lab288P1bin103 | Isolate | Unclassified |
| 85 | 2820911766 | Unclassified Actinobacteria Emb289P3bin96 | Isolate | Unclassified |
| 86 | 2831736028 | Parasaccharibacter apium A29 | Isolate | Apidae |
| 87 | 2834852038 | Acetobacter cibinongensis DsW_47 | Isolate | Drosophilidae |
| 88 | 2858105562 | Acetobacter sp. DsW_059 | Isolate | Drosophilidae |
| 89 | 2873620646 | Leucobacter coleopterorum HDW9A | Isolate | Dytiscidae |
| 90 | 2883361506 | Luteimicrobium xylanilyticum HY-24 | Isolate | Cerambycidae |
| 91 | 2894935787 | Leucobacter sp. OLJS4 | Isolate | Anthocoridae |
| 92 | 2900132049 | Bartonella massiliensis OS09 | Isolate | Unclassified |
| 93 | 2909881144 | Kocuria sp. cx-455 | Isolate | Cambaridae |
| 94 | 2915160415 | Leucobacter sp. cx-328 | Isolate | Cambaridae |
| 95 | 2918394494 | Microbacterium imperiale DSM 20530 | Isolate | Unclassified |
| 96 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 97 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 98 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 99 | 8012935351 | Brevibacterium epidermidis UD i117 | Isolate | Unclassified |
| 100 | 8068950955 | Bartonella apihabitans W8097 | Isolate | Apidae |
| 101 | 8073621894 | Bartonella apis W8099 | Isolate | Apidae |
| 102 | 8074812948 | Bombella apis MRM1 | Isolate | Apidae |
| 103 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 104 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 105 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 106 | 3300007139 | Ant gut microbial communities from Cephalotes pellans, Brazil | Metagenome | Formicidae |
| 107 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 108 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 109 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 110 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 111 | 2515154104 | Streptomyces sp. KhCrAH-244 | Isolate | Unclassified |
| 112 | 2524023214 | Leucobacter chironomi DSM 19883 | Isolate | Chironomidae |
| 113 | 2675903497 | Pseudonocardia sp. EC080610-09 | Isolate | Formicidae |
| 114 | 2681812870 | Oerskovia enterophila DFA-19 | Isolate | Unclassified |
| 115 | 2751185856 | Bartonella apis BBC0244 | Isolate | Apidae |
| 116 | 2816332478 | Acetobacter tropicalis BDGP1 | Isolate | Drosophilidae |
| 117 | 2820909719 | Unclassified Actinobacteria Emb289P4bin20 | Isolate | Unclassified |
| 118 | 2843864159 | Acetobacter pomorum SH | Isolate | Drosophilidae |
| 119 | 2848356102 | Xylanimonas allomyrinae 2JSPR-7 | Isolate | Scarabaeidae |
| 120 | 2856966858 | Pseudonocardia sp. Ae263_Ps1 | Isolate | Formicidae |
| 121 | 2862075925 | Corynebacterium lactis S064 | Isolate | Ixodidae |
| 122 | 2864761044 | Stenotrophomonas rhizophilia S00008 | Isolate | Elmidae |
| 123 | 2868677537 | Acetobacter orientalis DsW_061 | Isolate | Drosophilidae |
| 124 | 2894932631 | Leucobacter sp. OAMLP11 | Isolate | Anthocoridae |
| 125 | 2894966443 | Leucobacter sp. OLCALW19 | Isolate | Anthocoridae |
| 126 | 2910090113 | Kocuria sp. cx-116 | Isolate | Cambaridae |
| 127 | 2920412021 | Bombella sp. ESL0387 | Isolate | Apidae |
| 128 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 129 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 130 | 649989992 | Pseudonocardia sp. P1 | Isolate | Formicidae |
| 131 | 651324000 | Acetobacter pomorum DM001 | Isolate | Drosophilidae |
| 132 | 8053361298 | Streptomyces formicae 1H-GS9 | Isolate | Unclassified |
| 133 | 8067987626 | Agromyces larvae CFWR-12 | Isolate | Unclassified |
| 134 | 8073617375 | Bartonella apis W8098 | Isolate | Apidae |
| 135 | 8074809037 | Bombella apis MRM1 | Isolate | Apidae |
| 136 | 8082291289 | Bartonella apihabitans K-FP28 | Isolate | Apidae |
| 137 | 3300006995 | Ant gut microbial communities from Cephalotes angustus, Brazil | Metagenome | Formicidae |
| 138 | 3300007042 | Ant gut microbial communities from Cephalotes pusillus, Brazil | Metagenome | Formicidae |
| 139 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 140 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 141 | 2505679068 | Isoptericola variabilis 225 | Isolate | Unclassified |
| 142 | 2671180625 | Pseudonocardia sp. EC080619-01 | Isolate | Formicidae |
| 143 | 2820845766 | Unclassified Actinobacteria Lab288P3bin96 | Isolate | Unclassified |
| 144 | 2820849606 | Unclassified Actinobacteria Lab288P3bin39 | Isolate | Unclassified |
| 145 | 2820889385 | Unclassified Actinobacteria Lab288P1bin133 | Isolate | Unclassified |
| 146 | 2820926697 | Unclassified Actinobacteria Emb289P3bin125 | Isolate | Unclassified |
| 147 | 2837204985 | Lysinimonas sp. 2DFWR-13 | Isolate | Scarabaeidae |
| 148 | 2854548700 | Acetobacter persici DmL_053 | Isolate | Drosophilidae |
| 149 | 2864870719 | Comamonas odontotermitis S00124 | Isolate | Elmidae |
| 150 | 2868683769 | Acetobacter sp. DmW_043 | Isolate | Drosophilidae |
| 151 | 2873586004 | Sanguibacter sp. HDW7 | Isolate | Hydrophilidae |
| 152 | 2894944011 | Leucobacter sp. OLAS13 | Isolate | Anthocoridae |
| 153 | 2915166107 | Leucobacter sp. cx-87 | Isolate | Cambaridae |
| 154 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 155 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 156 | 8073624232 | Bartonella sp. W8151 | Isolate | Apidae |
| 157 | 8074810961 | Bombella apis SME1 | Isolate | Apidae |
| 158 | 8077775691 | Tsukamurella sp. PLM1 | Isolate | Formicidae |
| 159 | 3300012818 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG | Metagenome | |
| 160 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 161 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 162 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 163 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 164 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 165 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 166 | 2548876789 | Xanthomonas sacchari NCPPB 4393 | Isolate | |
| 167 | 2751185853 | Bartonella apis BBC0178 | Isolate | Apidae |
| 168 | 2786546124 | Acetobacter sp. JWB | Isolate | Drosophilidae |
| 169 | 2820867525 | Unclassified Actinobacteria Lab288P3bin128 | Isolate | Unclassified |
| 170 | 2841168549 | Agromyces protaetiae FW100M-8 | Isolate | Scarabaeidae |
| 171 | 2854520951 | Acetobacter pasteurianus AD | Isolate | Unclassified |
| 172 | 2854536247 | Acetobacter senegalensis DmL_050 | Isolate | Drosophilidae |
| 173 | 2858102877 | Acetobacter orientalis DmW_048 | Isolate | Drosophilidae |
| 174 | 2858129007 | Acetobacter orientalis DmW_045 | Isolate | Drosophilidae |
| 175 | 2864918810 | Tsukamurella ocularis S00175 | Isolate | Elmidae |
| 176 | 2864960361 | Comamonas odontotermitis S00229 | Isolate | Elmidae |
| 177 | 2873614151 | Leucobacter viscericola HDW9C | Isolate | Dytiscidae |
| 178 | 2884351759 | Cellulosimicrobium sp. BI34T | Isolate | Pyralidae |
| 179 | 2894897082 | Leucobacter sp. OLCS4 | Isolate | Anthocoridae |
| 180 | 2894974975 | Leucobacter sp. OLIS6 | Isolate | Anthocoridae |
| 181 | 8068944069 | Bartonella choladocola W8125 | Isolate | Apidae |
| 182 | 8068955631 | Bartonella apihabitans M0280 | Isolate | Apidae |
| 183 | 8073628750 | Bartonella sp. W8167 | Isolate | Apidae |
| 184 | 3300007083 | Ant gut microbial communities from Cephalotes persimilis, Brazil | Metagenome | Formicidae |
| 185 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 186 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 187 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 188 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 189 | 2518645556 | Nocardiopsis alba ATCC BAA-2165 | Isolate | Apidae |
| 190 | 2597490292 | Acetobacter malorum DmCS_005 | Isolate | Drosophilidae |
| 191 | 2648501628 | Xanthomonas sp. Cag60 | Isolate | Unclassified |
| 192 | 2718217924 | Pseudonocardia sp. HH130630-07 | Isolate | Formicidae |
| 193 | 2772190761 | Rhodococcus rhodnii NRRL B-16535 | Isolate | Unclassified |
| 194 | 2820803007 | Unclassified Actinobacteria Th196P3bin61 | Isolate | Unclassified |
| 195 | 2820838073 | Unclassified Actinobacteria Lab288P4bin27 | Isolate | Unclassified |
| 196 | 2820842553 | Unclassified Actinobacteria Lab288P4bin104 | Isolate | Unclassified |
| 197 | 2820929059 | Unclassified Actinobacteria Emb289P3bin110 | Isolate | Unclassified |
| 198 | 2834143536 | Parasaccharibacter apium AS1 | Isolate | Apidae |
| 199 | 2834160066 | Parasaccharibacter apium B8 | Isolate | Apidae |
| 200 | 2847305884 | Microbacterium protaetiae DFW100M-13 | Isolate | Scarabaeidae |
| 201 | 2864773010 | Tsukamurella ocularis S00022 | Isolate | Elmidae |
| 202 | 2864976888 | Novosphingobium chloroacetimidivorans S00245 | Isolate | Elmidae |
| 203 | 2894981435 | Leucobacter sp. OLDS2 | Isolate | Anthocoridae |
| 204 | 2899194184 | Bombella sp. ESL0378 | Isolate | Apidae |
| 205 | 2920413932 | Bombella sp. ESL0380 | Isolate | Apidae |
| 206 | 8068953321 | Bartonella apihabitans M0190 | Isolate | Apidae |
| 207 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 208 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 209 | 3300007141 | Ant gut microbial communities from Cephalotes maculatus, Brazil | Metagenome | Formicidae |
| 210 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 211 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 212 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 213 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 214 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 215 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 216 | 3300012850 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG | Metagenome | Culicidae |
| 217 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 218 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 219 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0562379_0030 | 3300056790 | Bacteria | 773812 |
| 2 | Ga0562378_0559 | 3300056814 | Unclassified | 60388 |
| 3 | Ga0562375_0291 | 3300056856 | Bacteria | 127083 |
| 4 | Ga0562375_4144 | 3300056856 | Bacteria | 11660 |
| 5 | Ga0123357_10105921 | 3300009784 | Bacteria | 3606 |
| 6 | Ga0123356_10032861 | 3300010049 | Bacteria | 4852 |
| 7 | Ga0123353_10224497 | 3300010167 | Bacteria | 2934 |
| 8 | Ga0160441_100594 | 3300012825 | Bacteria | 23225 |
| 9 | Ga0160431_100614 | 3300012828 | Bacteria | 13149 |
| 10 | Ga0160447_106893 | 3300012849 | Unclassified | 2937 |
| 11 | Ga0160434_104534 | 3300012850 | Bacteria | 2315 |
| 12 | Ga0160457_1000006 | 3300012858 | Bacteria | 519848 |
| 13 | Ga0466704_360510 | 3300042643 | Bacteria | 7834 |
| 14 | Ga0466708_454109 | 3300042652 | Bacteria | 2580 |
| 15 | Ga0466725_334312 | 3300042654 | Bacteria | 1534 |
| 16 | CVPL005W_1003650 | 3300002934 | Bacteria | 2591 |
| 17 | Ga0103266_1002548 | 3300007067 | Bacteria | 5079 |
| 18 | Ga0103266_1003919 | 3300007067 | Bacteria | 2065 |
| 19 | Ga0102738_1002746 | 3300007141 | Bacteria | 2609 |
| 20 | Ga0562378_2744 | 3300056814 | Unclassified | 13234 |
| 21 | Ga0562375_0610 | 3300056856 | Bacteria | 68256 |
| 22 | Ga0562376_2787 | 3300056857 | Unclassified | 19576 |
| 23 | Ga0123353_10000308 | 3300010167 | Bacteria | 60374 |
| 24 | Ga0123353_10164572 | 3300010167 | Bacteria | 3527 |
| 25 | Ga0160470_100148 | 3300012813 | Bacteria | 70238 |
| 26 | Ga0160443_100332 | 3300012848 | Unclassified | 43417 |
| 27 | Ga0160457_1000220 | 3300012858 | Unclassified | 42751 |
| 28 | Ga0160457_1001987 | 3300012858 | Bacteria | 4826 |
| 29 | Ga0160436_1000175 | 3300012861 | Bacteria | 32174 |
| 30 | Ga0415639_054723 | 3300038395 | Bacteria | 8985 |
| 31 | Ga0466730_093937 | 3300042625 | Bacteria | 26828 |
| 32 | Ga0466703_230474 | 3300042636 | Bacteria | 13370 |
| 33 | Ga0466704_074527 | 3300042643 | Bacteria | 5220 |
| 34 | Ga0466724_33003 | 3300042649 | Bacteria | 6143 |
| 35 | Ga0466724_66581 | 3300042649 | Bacteria | 665985 |
| 36 | AustNasuHG_c1000117 | 3300000089 | Bacteria | 24255 |
| 37 | Ga0074278_117381 | 3300005721 | Bacteria | 2625 |
| 38 | Ga0103263_100060 | 3300007042 | Bacteria | 26142 |
| 39 | Ga0103265_1000505 | 3300007068 | Bacteria | 12217 |
| 40 | Ga0102735_1003116 | 3300007080 | Bacteria | 2378 |
| 41 | Ga0103260_1000041 | 3300007139 | Bacteria | 50082 |
| 42 | Ga0102738_1000642 | 3300007141 | Bacteria | 5672 |
| 43 | Ga0530661_004200 | 3300056564 | Bacteria | 4455 |
| 44 | Ga0562379_0016 | 3300056790 | Bacteria | 1192610 |
| 45 | Ga0562379_3224 | 3300056790 | Bacteria | 11335 |
| 46 | Ga0562378_0006 | 3300056814 | Bacteria | 1902205 |
| 47 | Ga0562378_0024 | 3300056814 | Bacteria | 629891 |
| 48 | Ga0123353_10130481 | 3300010167 | Bacteria | 4033 |
| 49 | Ga0466723_198703 | 3300042618 | Bacteria | 8878 |
| 50 | Ga0466706_169901 | 3300042599 | Bacteria | 4763 |
| 51 | Ga0466719_084344 | 3300042606 | Bacteria | 14579 |
| 52 | Ga0160432_101378 | 3300012818 | Bacteria | 8009 |
| 53 | Ga0160432_102530 | 3300012818 | Bacteria | 3775 |
| 54 | Ga0160469_100399 | 3300012824 | Bacteria | 22753 |
| 55 | Ga0160452_101671 | 3300012834 | Bacteria | 5896 |
| 56 | Ga0160455_101787 | 3300012837 | Bacteria | 5540 |
| 57 | Ga0160447_100939 | 3300012849 | Unclassified | 12176 |
| 58 | Ga0160430_100338 | 3300012852 | Bacteria | 29678 |
| 59 | Ga0160435_1000086 | 3300012857 | Bacteria | 54466 |
| 60 | Ga0160435_1000140 | 3300012857 | Bacteria | 40834 |
| 61 | Ga0160457_1000026 | 3300012858 | Bacteria | 301819 |
| 62 | Ga0466657_250207 | 3300042582 | Bacteria | 6119 |
| 63 | Ga0466696_498106 | 3300042596 | Bacteria | 2998 |
| 64 | Ga0466730_005028 | 3300042625 | Bacteria | 26317 |
| 65 | Ga0466703_081658 | 3300042636 | Bacteria | 26167 |
| 66 | CVPL010W_10000120 | 3300002931 | Bacteria | 59667 |
| 67 | Ga0102733_100772 | 3300006995 | Bacteria | 1879 |
| 68 | Ga0102736_1000022 | 3300007052 | Bacteria | 138148 |
| 69 | Ga0103260_1005082 | 3300007139 | Bacteria | 1960 |
| 70 | Ga0102738_1000737 | 3300007141 | Bacteria | 5265 |
| 71 | Ga0102737_1000009 | 3300007142 | Bacteria | 60941 |
| 72 | Ga0466705_166783 | 3300042612 | Bacteria | 45204 |
| 73 | Ga0562376_0349 | 3300056857 | Unclassified | 89347 |
| 74 | Ga0562374_0483 | 3300057007 | Bacteria | 66905 |
| 75 | Ga0123357_10247628 | 3300009784 | Bacteria | 1915 |
| 76 | Ga0123356_10013917 | 3300010049 | Bacteria | 7746 |
| 77 | Ga0123353_10061251 | 3300010167 | Bacteria | 6034 |
| 78 | Ga0123354_10056404 | 3300010882 | Bacteria | 5866 |
| 79 | Ga0466711_100408 | 3300042615 | Bacteria | 23458 |
| 80 | Ga0466701_098870 | 3300042598 | Bacteria | 37596 |
| 81 | Ga0466706_100517 | 3300042599 | Bacteria | 31011 |
| 82 | Ga0466722_203611 | 3300042609 | Bacteria | 107234 |
| 83 | Ga0160456_100133 | 3300012820 | Bacteria | 70892 |
| 84 | Ga0160441_100810 | 3300012825 | Unclassified | 15896 |
| 85 | Ga0160467_101380 | 3300012829 | Unclassified | 9949 |
| 86 | Ga0160459_100079 | 3300012831 | Bacteria | 108791 |
| 87 | Ga0466729_304545 | 3300042621 | Bacteria | 4822 |
| 88 | Ga0466734_091428 | 3300042623 | Bacteria | 18838 |
| 89 | Ga0466730_085996 | 3300042625 | Bacteria | 38700 |
| 90 | Ga0466703_393877 | 3300042636 | Bacteria | 98275 |
| 91 | Ga0103264_1013089 | 3300007188 | Bacteria | 5065 |
| 92 | Ga0530661_001847 | 3300056564 | Bacteria | 9367 |
| 93 | Ga0562378_0839 | 3300056814 | Unclassified | 41077 |
| 94 | Ga0562375_0002 | 3300056856 | Bacteria | 3523859 |
| 95 | Ga0562375_1652 | 3300056856 | Bacteria | 28779 |
| 96 | Ga0562376_1573 | 3300056857 | Unclassified | 31295 |
| 97 | Ga0123353_10058850 | 3300010167 | Bacteria | 6159 |
| 98 | Ga0466707_222809 | 3300042601 | Bacteria | 6983 |
| 99 | Ga0466707_266046 | 3300042601 | Bacteria | 4953 |
| 100 | Ga0466713_110889 | 3300042602 | Bacteria | 35385 |
| 101 | Ga0160459_101917 | 3300012831 | Bacteria | 3821 |
| 102 | Ga0160446_100403 | 3300012835 | Bacteria | 21084 |
| 103 | Ga0160448_100116 | 3300012854 | Bacteria | 38451 |
| 104 | Ga0160436_1000222 | 3300012861 | Bacteria | 27741 |
| 105 | Ga0466696_320963 | 3300042596 | Bacteria | 13939 |
| 106 | Ga0466703_371370 | 3300042636 | Bacteria | 5830 |
| 107 | CVPL010W_10015789 | 3300002931 | Bacteria | 5220 |
| 108 | Ga0103261_1000334 | 3300007083 | Unclassified | 17818 |
| 109 | Ga0123357_10000589 | 3300009784 | Bacteria | 35908 |
| 110 | Ga0562378_1480 | 3300056814 | Bacteria | 25266 |
| 111 | Ga0562376_6023 | 3300056857 | Bacteria | 6473 |
| 112 | Ga0562374_2091 | 3300057007 | Unclassified | 19533 |
| 113 | Ga0123356_10000068 | 3300010049 | Bacteria | 108740 |
| 114 | Ga0123356_10000676 | 3300010049 | Bacteria | 37752 |
| 115 | Ga0123354_10280765 | 3300010882 | Bacteria | 1618 |
| 116 | Ga0160454_101101 | 3300012798 | Unclassified | 4578 |
| 117 | Ga0160464_100237 | 3300012805 | Bacteria | 53498 |
| 118 | Ga0466707_154911 | 3300042601 | Bacteria | 3274 |
| 119 | Ga0466707_382854 | 3300042601 | Bacteria | 200054 |
| 120 | Ga0466713_065581 | 3300042602 | Bacteria | 52137 |
| 121 | Ga0160440_100073 | 3300012815 | Bacteria | 122713 |
| 122 | Ga0160452_100205 | 3300012834 | Bacteria | 63686 |
| 123 | Ga0160446_100323 | 3300012835 | Bacteria | 27155 |
| 124 | Ga0160434_100541 | 3300012850 | Bacteria | 9675 |
| 125 | Ga0466693_354246 | 3300042592 | Bacteria | 62518 |
| 126 | Ga0466735_019925 | 3300042624 | Bacteria | 1338 |
| 127 | Ga0466703_111323 | 3300042636 | Bacteria | 3747 |
| 128 | Ga0466727_126145 | 3300042655 | Bacteria | 1361 |
| 129 | Ga0103263_101306 | 3300007042 | Bacteria | 3244 |
| 130 | Ga0103263_102980 | 3300007042 | Bacteria | 2051 |
| 131 | Ga0103261_1008590 | 3300007083 | Bacteria | 2524 |
| 132 | Ga0102739_1000277 | 3300007095 | Bacteria | 18512 |
| 133 | Ga0103260_1001990 | 3300007139 | Bacteria | 3540 |
| 134 | Ga0103260_1002154 | 3300007139 | Bacteria | 3378 |
| 135 | Ga0102740_1001625 | 3300007140 | Bacteria | 5562 |
| 136 | Ga0102738_1000064 | 3300007141 | Bacteria | 83878 |
| 137 | Ga0466705_009364 | 3300042612 | Bacteria | 2029 |
| 138 | Ga0562376_0008 | 3300056857 | Bacteria | 1266359 |
| 139 | Ga0562376_1956 | 3300056857 | Bacteria | 26751 |
| 140 | Ga0466718_142322 | 3300042617 | Bacteria | 6319 |
| 141 | Ga0466706_166351 | 3300042599 | Bacteria | 10416 |
| 142 | Ga0160431_101020 | 3300012828 | Bacteria | 8568 |
| 143 | Ga0160459_102641 | 3300012831 | Bacteria | 2828 |
| 144 | Ga0160444_100091 | 3300012841 | Bacteria | 113908 |
| 145 | Ga0160430_102050 | 3300012852 | Bacteria | 6705 |
| 146 | Ga0160457_1000008 | 3300012858 | Bacteria | 511605 |
| 147 | Ga0466701_008647 | 3300042598 | Bacteria | 4182 |
| 148 | Ga0466730_045706 | 3300042625 | Bacteria | 6018 |
| 149 | Ga0466724_14614 | 3300042649 | Bacteria | 32602 |
| 150 | Ga0466724_46140 | 3300042649 | Bacteria | 630192 |
| 151 | JGI24699J35502_11133592 | 3300002509 | Bacteria | 12324 |
| 152 | Ga0074278_136700 | 3300005721 | Unclassified | 6511 |
| 153 | Ga0103261_1001571 | 3300007083 | Bacteria | 4215 |
| 154 | Ga0102734_1000005 | 3300007129 | Bacteria | 74314 |
| 155 | Ga0103268_1000170 | 3300007192 | Bacteria | 21581 |
| 156 | Ga0562377_0007 | 3300056842 | Bacteria | 3019242 |
| 157 | Ga0123357_10171976 | 3300009784 | Bacteria | 2559 |
| 158 | Ga0123353_10000623 | 3300010167 | Bacteria | 43400 |
| 159 | Ga0123354_10130970 | 3300010882 | Bacteria | 3168 |
| 160 | Ga0123354_10231700 | 3300010882 | Bacteria | 1929 |
| 161 | Ga0466707_114750 | 3300042601 | Bacteria | 67340 |
| 162 | Ga0466713_122414 | 3300042602 | Bacteria | 2393 |
| 163 | Ga0160468_100001 | 3300012819 | Bacteria | 1115787 |
| 164 | Ga0160441_100734 | 3300012825 | Bacteria | 17925 |
| 165 | Ga0160455_101722 | 3300012837 | Bacteria | 5770 |
| 166 | Ga0160434_100070 | 3300012850 | Bacteria | 71817 |
| 167 | Ga0160430_103391 | 3300012852 | Bacteria | 4423 |
| 168 | Ga0160448_100147 | 3300012854 | Bacteria | 33346 |
| 169 | Ga0160436_1000295 | 3300012861 | Unclassified | 22259 |
| 170 | Ga0072940_1085735 | 3300005200 | Bacteria | 4630 |
| 171 | Ga0102736_1000573 | 3300007052 | Bacteria | 7373 |
| 172 | Ga0102739_1001658 | 3300007095 | Bacteria | 3628 |
| 173 | Ga0102734_1001275 | 3300007129 | Bacteria | 9270 |
| 174 | Ga0102734_1001865 | 3300007129 | Bacteria | 5109 |
| 175 | Ga0102740_1000039 | 3300007140 | Bacteria | 31302 |
| 176 | Ga0102737_1000497 | 3300007142 | Bacteria | 12806 |
| 177 | Ga0104050_1200408 | 3300007153 | Bacteria | 2362 |
| 178 | Ga0103268_1007513 | 3300007192 | Bacteria | 2227 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01063 | Aminotran_4 | Amino-transferase class IV | 136 | 381 | 0.87 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01063 | GO:0003824 | catalytic activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.