Protein Family IF01730

Metagenome Isolate
319 Members
219 Samples
178 Scaffolds
368.16 Avg Length

🧬 Representative Sequence

ID
3300007139|Ga0103260_1000041|Ga0103260_10000415
Length
428 aa
Sequence
MGILVYRGCFPPPKRLFFTNLGLCLHSLNPQALTSRLDSRIISNRSPRHLQGTFVPTASSSTDLSCAFQITPHPQPRCPDERAKILAAPGFGQHFSDHMVRISWEKERLWHDAQVLPYGPISLNPAAAVLHYGQEVFEGLKAYRHADGSVWAFRPEANGQRLQRSAQRLALPPLPLELFIASLKQLITIDHDWVPSGGESSLYLRPFLIGDEAYLGVRASHKASYYLIASPAGAYFSGGIAPVSIWLADNYARAAGKGGTGAAKCGGNYAASLLPQMQAQAQGCSQVLFLDPVEGRYLEELGGMNVFLVYGQSNTLVTPALTGSILEGITRDSILQLARDRGMHTEERKILLSEWVDGVRSGEITEIFACGTAAVITPIGQLKGENLSVGEANAAPGPVSLSLRQALTDIQYGRAPDPHGWMQRLDA*

πŸ“Š Sample Types

Isolate 44.2%
Metagenome 55.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Unclassified 17.1%
Apidae 14.3%
Formicidae 12.4%
Drosophilidae 10.0%
Termitidae 8.6%
Culicidae 4.3%
Anthocoridae 4.3%
Scarabaeidae 3.8%
Tenebrionidae 3.8%
Armadillidiidae 3.8%
Kalotermitidae 3.8%
Cambaridae 2.9%
Elmidae 2.9%
Dytiscidae 1.4%
Hydrophilidae 1.4%
Termopsidae 1.0%
Rhinotermitidae 1.0%
Curculionidae 0.5%
Siricidae 0.5%
Hodotermitidae 0.5%
Cerambycidae 0.5%
Chironomidae 0.5%
Ixodidae 0.5%
Pyralidae 0.5%

🌳 Taxonomy

Archaea 0
Bacteria 302
Eukaryota 0
Viruses 0
Unclassified 17

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2617271320 Acetobacter pomorum DmCS_004 Isolate Drosophilidae
2 2836973655 Gryllotalpicola protaetiae 2DFW10M-5 Isolate Scarabaeidae
3 2854518031 Acetobacter indonesiensis DmW_046 Isolate Drosophilidae
4 2856671350 Pseudonocardia sp. Ae356_Ps1 Isolate Formicidae
5 2856947901 Pseudonocardia sp. Ae168_Ps1 Isolate Formicidae
6 2908241010 Streptomyces sp. HF10 Isolate Termitidae
7 2918390780 Glutamicibacter protophormiae DSM 20168 Isolate Unclassified
8 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
9 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
10 8030347546 Propionimicrobium sp. PCR01-08-3 Isolate Tenebrionidae
11 8069511479 Arthrobacter ipsi IA7 Isolate Curculionidae
12 8073626464 Bartonella apis W8152 Isolate Apidae
13 3006468911 Streptomyces sp. RB17 Isolate Termitidae
14 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
15 3300007095 Ant gut microbial communities from Cephalotes minutus, Brazil Metagenome Formicidae
16 3300012813 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG Metagenome Culicidae
17 3300012828 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG Metagenome
18 3300012841 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG Metagenome Armadillidiidae
19 3300012852 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG Metagenome
20 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
21 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
22 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
23 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
24 2523533511 Streptomyces sp. Sv. ACTE SirexAA-E Isolate Siricidae
25 2731957681 Xylanimicrobium pachnodae JCM 13526, NBRC 107786 Isolate Scarabaeidae
26 2751185858 Bartonella apis BBC0122 Isolate Apidae
27 2791354941 Bombella intestini R-52487 Isolate Unclassified
28 2818991320 Klugiella xanthotipulae DSM 18031 Isolate Unclassified
29 2820863028 Unclassified Actinobacteria Lab288P3bin164 Isolate Unclassified
30 2858084324 Acetobacter sp. DsW_54 Isolate Drosophilidae
31 2858119979 Acetobacter malorum DsW_057 Isolate Drosophilidae
32 2861945162 Microbacterium sp. AR7-10 Isolate Culicidae
33 2873617540 Leucobacter insecticola HDW9B Isolate Dytiscidae
34 2883683260 Protaetiibacter larvae KACC 19322 Isolate Scarabaeidae
35 2888667245 Corynebacterium diphtheriae FRC0190 Isolate Unclassified
36 2894900265 Leucobacter sp. OLTLW20 Isolate Anthocoridae
37 2894929448 Leucobacter sp. OAMSW11 Isolate Anthocoridae
38 2915168811 Leucobacter sp. cx-169 Isolate Cambaridae
39 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
40 8068941587 Bartonella choladocola B10834H15 Isolate Apidae
41 8073619611 Bartonella apis B10834G6 Isolate Apidae
42 3002678670 Agromyces sp. G127AT Isolate Unclassified
43 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
44 3300012798 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG Metagenome
45 3300012805 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG Metagenome
46 3300012815 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG Metagenome
47 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
48 2504756063 Isoptericola variabilis J5 Isolate Unclassified
49 2648501322 Streptomyces sp. SA3_actF Isolate Unclassified
50 2834165886 Saccharibacter sp. M18 Isolate Apidae
51 2854576727 Acetobacter okinawensis DsW_060 Isolate Drosophilidae
52 2858089842 Acetobacter tropicalis DmW_042 Isolate Drosophilidae
53 2858110640 Acetobacter indonesiensis DmL_051 Isolate Drosophilidae
54 2859977607 Pseudonocardia sp. Ae707_Ps1 Isolate Formicidae
55 2873558832 Propioniciclava coleopterorum HDW11 Isolate Hydrophilidae
56 2873562573 Thermomonas sp. HDW16 Isolate Hydrophilidae
57 2884613238 Agromyces intestinalis KACC 19306 Isolate Scarabaeidae
58 2901819457 Bombella sp. ESL0385 Isolate Apidae
59 2915157839 Leucobacter sp. cx-42 Isolate Cambaridae
60 2820944107 Unclassified Actinobacteria Cu122P5bin14 Isolate Unclassified
61 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
62 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
63 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
64 3300056564 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) Metagenome Tenebrionidae
65 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
66 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
67 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
68 8068946563 Bartonella apihabitans M0187 Isolate Apidae
69 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
70 3300002934 Ant worker gut metagenome for colony PL005 Metagenome Formicidae
71 3300007052 Ant gut microbial communities from Cephalotes eduarduli, Brazil Metagenome Formicidae
72 3300007080 Ant gut microbial communities from Cephalotes clypeatus, Brazil Metagenome Formicidae
73 3300007153 Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut Metagenome Drosophilidae
74 3300007192 Ant gut microbial communities from Cephalotes persimplex, Brazil Metagenome Formicidae
75 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
76 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
77 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
78 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
79 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
80 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
81 2751185679 Parasaccharibacter apium G7_7_3c Isolate Apidae
82 2816332114 Microbacterium saperdae DSM 20169 Isolate Unclassified
83 2820825283 Unclassified Actinobacteria Nt197P3bin111 Isolate Unclassified
84 2820894511 Unclassified Actinobacteria Lab288P1bin103 Isolate Unclassified
85 2820911766 Unclassified Actinobacteria Emb289P3bin96 Isolate Unclassified
86 2831736028 Parasaccharibacter apium A29 Isolate Apidae
87 2834852038 Acetobacter cibinongensis DsW_47 Isolate Drosophilidae
88 2858105562 Acetobacter sp. DsW_059 Isolate Drosophilidae
89 2873620646 Leucobacter coleopterorum HDW9A Isolate Dytiscidae
90 2883361506 Luteimicrobium xylanilyticum HY-24 Isolate Cerambycidae
91 2894935787 Leucobacter sp. OLJS4 Isolate Anthocoridae
92 2900132049 Bartonella massiliensis OS09 Isolate Unclassified
93 2909881144 Kocuria sp. cx-455 Isolate Cambaridae
94 2915160415 Leucobacter sp. cx-328 Isolate Cambaridae
95 2918394494 Microbacterium imperiale DSM 20530 Isolate Unclassified
96 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
97 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
98 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
99 8012935351 Brevibacterium epidermidis UD i117 Isolate Unclassified
100 8068950955 Bartonella apihabitans W8097 Isolate Apidae
101 8073621894 Bartonella apis W8099 Isolate Apidae
102 8074812948 Bombella apis MRM1 Isolate Apidae
103 3300005721 Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 Metagenome Apidae
104 3300007067 Ant gut microbial communities from Cephalotes spinosus, Peru Metagenome Formicidae
105 3300007068 Ant gut microbial communities from Cephalotes simillimus, Peru Metagenome Formicidae
106 3300007139 Ant gut microbial communities from Cephalotes pellans, Brazil Metagenome Formicidae
107 3300012820 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG Metagenome Armadillidiidae
108 3300012825 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG Metagenome
109 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae
110 3300012861 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG Metagenome Culicidae
111 2515154104 Streptomyces sp. KhCrAH-244 Isolate Unclassified
112 2524023214 Leucobacter chironomi DSM 19883 Isolate Chironomidae
113 2675903497 Pseudonocardia sp. EC080610-09 Isolate Formicidae
114 2681812870 Oerskovia enterophila DFA-19 Isolate Unclassified
115 2751185856 Bartonella apis BBC0244 Isolate Apidae
116 2816332478 Acetobacter tropicalis BDGP1 Isolate Drosophilidae
117 2820909719 Unclassified Actinobacteria Emb289P4bin20 Isolate Unclassified
118 2843864159 Acetobacter pomorum SH Isolate Drosophilidae
119 2848356102 Xylanimonas allomyrinae 2JSPR-7 Isolate Scarabaeidae
120 2856966858 Pseudonocardia sp. Ae263_Ps1 Isolate Formicidae
121 2862075925 Corynebacterium lactis S064 Isolate Ixodidae
122 2864761044 Stenotrophomonas rhizophilia S00008 Isolate Elmidae
123 2868677537 Acetobacter orientalis DsW_061 Isolate Drosophilidae
124 2894932631 Leucobacter sp. OAMLP11 Isolate Anthocoridae
125 2894966443 Leucobacter sp. OLCALW19 Isolate Anthocoridae
126 2910090113 Kocuria sp. cx-116 Isolate Cambaridae
127 2920412021 Bombella sp. ESL0387 Isolate Apidae
128 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
129 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
130 649989992 Pseudonocardia sp. P1 Isolate Formicidae
131 651324000 Acetobacter pomorum DM001 Isolate Drosophilidae
132 8053361298 Streptomyces formicae 1H-GS9 Isolate Unclassified
133 8067987626 Agromyces larvae CFWR-12 Isolate Unclassified
134 8073617375 Bartonella apis W8098 Isolate Apidae
135 8074809037 Bombella apis MRM1 Isolate Apidae
136 8082291289 Bartonella apihabitans K-FP28 Isolate Apidae
137 3300006995 Ant gut microbial communities from Cephalotes angustus, Brazil Metagenome Formicidae
138 3300007042 Ant gut microbial communities from Cephalotes pusillus, Brazil Metagenome Formicidae
139 3300007142 Ant gut microbial communities from Cephalotes grandinosus, Brazil Metagenome Formicidae
140 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
141 2505679068 Isoptericola variabilis 225 Isolate Unclassified
142 2671180625 Pseudonocardia sp. EC080619-01 Isolate Formicidae
143 2820845766 Unclassified Actinobacteria Lab288P3bin96 Isolate Unclassified
144 2820849606 Unclassified Actinobacteria Lab288P3bin39 Isolate Unclassified
145 2820889385 Unclassified Actinobacteria Lab288P1bin133 Isolate Unclassified
146 2820926697 Unclassified Actinobacteria Emb289P3bin125 Isolate Unclassified
147 2837204985 Lysinimonas sp. 2DFWR-13 Isolate Scarabaeidae
148 2854548700 Acetobacter persici DmL_053 Isolate Drosophilidae
149 2864870719 Comamonas odontotermitis S00124 Isolate Elmidae
150 2868683769 Acetobacter sp. DmW_043 Isolate Drosophilidae
151 2873586004 Sanguibacter sp. HDW7 Isolate Hydrophilidae
152 2894944011 Leucobacter sp. OLAS13 Isolate Anthocoridae
153 2915166107 Leucobacter sp. cx-87 Isolate Cambaridae
154 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
155 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
156 8073624232 Bartonella sp. W8151 Isolate Apidae
157 8074810961 Bombella apis SME1 Isolate Apidae
158 8077775691 Tsukamurella sp. PLM1 Isolate Formicidae
159 3300012818 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG Metagenome
160 3300012834 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG Metagenome
161 3300012857 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG Metagenome Culicidae
162 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
163 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
164 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
165 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
166 2548876789 Xanthomonas sacchari NCPPB 4393 Isolate
167 2751185853 Bartonella apis BBC0178 Isolate Apidae
168 2786546124 Acetobacter sp. JWB Isolate Drosophilidae
169 2820867525 Unclassified Actinobacteria Lab288P3bin128 Isolate Unclassified
170 2841168549 Agromyces protaetiae FW100M-8 Isolate Scarabaeidae
171 2854520951 Acetobacter pasteurianus AD Isolate Unclassified
172 2854536247 Acetobacter senegalensis DmL_050 Isolate Drosophilidae
173 2858102877 Acetobacter orientalis DmW_048 Isolate Drosophilidae
174 2858129007 Acetobacter orientalis DmW_045 Isolate Drosophilidae
175 2864918810 Tsukamurella ocularis S00175 Isolate Elmidae
176 2864960361 Comamonas odontotermitis S00229 Isolate Elmidae
177 2873614151 Leucobacter viscericola HDW9C Isolate Dytiscidae
178 2884351759 Cellulosimicrobium sp. BI34T Isolate Pyralidae
179 2894897082 Leucobacter sp. OLCS4 Isolate Anthocoridae
180 2894974975 Leucobacter sp. OLIS6 Isolate Anthocoridae
181 8068944069 Bartonella choladocola W8125 Isolate Apidae
182 8068955631 Bartonella apihabitans M0280 Isolate Apidae
183 8073628750 Bartonella sp. W8167 Isolate Apidae
184 3300007083 Ant gut microbial communities from Cephalotes persimilis, Brazil Metagenome Formicidae
185 3300007140 Ant gut microbial communities from Cephalotes pallens, Brazil Metagenome Formicidae
186 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
187 3300012819 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG Metagenome Armadillidiidae
188 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
189 2518645556 Nocardiopsis alba ATCC BAA-2165 Isolate Apidae
190 2597490292 Acetobacter malorum DmCS_005 Isolate Drosophilidae
191 2648501628 Xanthomonas sp. Cag60 Isolate Unclassified
192 2718217924 Pseudonocardia sp. HH130630-07 Isolate Formicidae
193 2772190761 Rhodococcus rhodnii NRRL B-16535 Isolate Unclassified
194 2820803007 Unclassified Actinobacteria Th196P3bin61 Isolate Unclassified
195 2820838073 Unclassified Actinobacteria Lab288P4bin27 Isolate Unclassified
196 2820842553 Unclassified Actinobacteria Lab288P4bin104 Isolate Unclassified
197 2820929059 Unclassified Actinobacteria Emb289P3bin110 Isolate Unclassified
198 2834143536 Parasaccharibacter apium AS1 Isolate Apidae
199 2834160066 Parasaccharibacter apium B8 Isolate Apidae
200 2847305884 Microbacterium protaetiae DFW100M-13 Isolate Scarabaeidae
201 2864773010 Tsukamurella ocularis S00022 Isolate Elmidae
202 2864976888 Novosphingobium chloroacetimidivorans S00245 Isolate Elmidae
203 2894981435 Leucobacter sp. OLDS2 Isolate Anthocoridae
204 2899194184 Bombella sp. ESL0378 Isolate Apidae
205 2920413932 Bombella sp. ESL0380 Isolate Apidae
206 8068953321 Bartonella apihabitans M0190 Isolate Apidae
207 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
208 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
209 3300007141 Ant gut microbial communities from Cephalotes maculatus, Brazil Metagenome Formicidae
210 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
211 3300012824 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG Metagenome Armadillidiidae
212 3300012831 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG Metagenome Culicidae
213 3300012835 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG Metagenome Culicidae
214 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Armadillidiidae
215 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
216 3300012850 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG Metagenome Culicidae
217 3300012854 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG Metagenome Culicidae
218 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
219 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0562379_0030 3300056790 Bacteria 773812
2 Ga0562378_0559 3300056814 Unclassified 60388
3 Ga0562375_0291 3300056856 Bacteria 127083
4 Ga0562375_4144 3300056856 Bacteria 11660
5 Ga0123357_10105921 3300009784 Bacteria 3606
6 Ga0123356_10032861 3300010049 Bacteria 4852
7 Ga0123353_10224497 3300010167 Bacteria 2934
8 Ga0160441_100594 3300012825 Bacteria 23225
9 Ga0160431_100614 3300012828 Bacteria 13149
10 Ga0160447_106893 3300012849 Unclassified 2937
11 Ga0160434_104534 3300012850 Bacteria 2315
12 Ga0160457_1000006 3300012858 Bacteria 519848
13 Ga0466704_360510 3300042643 Bacteria 7834
14 Ga0466708_454109 3300042652 Bacteria 2580
15 Ga0466725_334312 3300042654 Bacteria 1534
16 CVPL005W_1003650 3300002934 Bacteria 2591
17 Ga0103266_1002548 3300007067 Bacteria 5079
18 Ga0103266_1003919 3300007067 Bacteria 2065
19 Ga0102738_1002746 3300007141 Bacteria 2609
20 Ga0562378_2744 3300056814 Unclassified 13234
21 Ga0562375_0610 3300056856 Bacteria 68256
22 Ga0562376_2787 3300056857 Unclassified 19576
23 Ga0123353_10000308 3300010167 Bacteria 60374
24 Ga0123353_10164572 3300010167 Bacteria 3527
25 Ga0160470_100148 3300012813 Bacteria 70238
26 Ga0160443_100332 3300012848 Unclassified 43417
27 Ga0160457_1000220 3300012858 Unclassified 42751
28 Ga0160457_1001987 3300012858 Bacteria 4826
29 Ga0160436_1000175 3300012861 Bacteria 32174
30 Ga0415639_054723 3300038395 Bacteria 8985
31 Ga0466730_093937 3300042625 Bacteria 26828
32 Ga0466703_230474 3300042636 Bacteria 13370
33 Ga0466704_074527 3300042643 Bacteria 5220
34 Ga0466724_33003 3300042649 Bacteria 6143
35 Ga0466724_66581 3300042649 Bacteria 665985
36 AustNasuHG_c1000117 3300000089 Bacteria 24255
37 Ga0074278_117381 3300005721 Bacteria 2625
38 Ga0103263_100060 3300007042 Bacteria 26142
39 Ga0103265_1000505 3300007068 Bacteria 12217
40 Ga0102735_1003116 3300007080 Bacteria 2378
41 Ga0103260_1000041 3300007139 Bacteria 50082
42 Ga0102738_1000642 3300007141 Bacteria 5672
43 Ga0530661_004200 3300056564 Bacteria 4455
44 Ga0562379_0016 3300056790 Bacteria 1192610
45 Ga0562379_3224 3300056790 Bacteria 11335
46 Ga0562378_0006 3300056814 Bacteria 1902205
47 Ga0562378_0024 3300056814 Bacteria 629891
48 Ga0123353_10130481 3300010167 Bacteria 4033
49 Ga0466723_198703 3300042618 Bacteria 8878
50 Ga0466706_169901 3300042599 Bacteria 4763
51 Ga0466719_084344 3300042606 Bacteria 14579
52 Ga0160432_101378 3300012818 Bacteria 8009
53 Ga0160432_102530 3300012818 Bacteria 3775
54 Ga0160469_100399 3300012824 Bacteria 22753
55 Ga0160452_101671 3300012834 Bacteria 5896
56 Ga0160455_101787 3300012837 Bacteria 5540
57 Ga0160447_100939 3300012849 Unclassified 12176
58 Ga0160430_100338 3300012852 Bacteria 29678
59 Ga0160435_1000086 3300012857 Bacteria 54466
60 Ga0160435_1000140 3300012857 Bacteria 40834
61 Ga0160457_1000026 3300012858 Bacteria 301819
62 Ga0466657_250207 3300042582 Bacteria 6119
63 Ga0466696_498106 3300042596 Bacteria 2998
64 Ga0466730_005028 3300042625 Bacteria 26317
65 Ga0466703_081658 3300042636 Bacteria 26167
66 CVPL010W_10000120 3300002931 Bacteria 59667
67 Ga0102733_100772 3300006995 Bacteria 1879
68 Ga0102736_1000022 3300007052 Bacteria 138148
69 Ga0103260_1005082 3300007139 Bacteria 1960
70 Ga0102738_1000737 3300007141 Bacteria 5265
71 Ga0102737_1000009 3300007142 Bacteria 60941
72 Ga0466705_166783 3300042612 Bacteria 45204
73 Ga0562376_0349 3300056857 Unclassified 89347
74 Ga0562374_0483 3300057007 Bacteria 66905
75 Ga0123357_10247628 3300009784 Bacteria 1915
76 Ga0123356_10013917 3300010049 Bacteria 7746
77 Ga0123353_10061251 3300010167 Bacteria 6034
78 Ga0123354_10056404 3300010882 Bacteria 5866
79 Ga0466711_100408 3300042615 Bacteria 23458
80 Ga0466701_098870 3300042598 Bacteria 37596
81 Ga0466706_100517 3300042599 Bacteria 31011
82 Ga0466722_203611 3300042609 Bacteria 107234
83 Ga0160456_100133 3300012820 Bacteria 70892
84 Ga0160441_100810 3300012825 Unclassified 15896
85 Ga0160467_101380 3300012829 Unclassified 9949
86 Ga0160459_100079 3300012831 Bacteria 108791
87 Ga0466729_304545 3300042621 Bacteria 4822
88 Ga0466734_091428 3300042623 Bacteria 18838
89 Ga0466730_085996 3300042625 Bacteria 38700
90 Ga0466703_393877 3300042636 Bacteria 98275
91 Ga0103264_1013089 3300007188 Bacteria 5065
92 Ga0530661_001847 3300056564 Bacteria 9367
93 Ga0562378_0839 3300056814 Unclassified 41077
94 Ga0562375_0002 3300056856 Bacteria 3523859
95 Ga0562375_1652 3300056856 Bacteria 28779
96 Ga0562376_1573 3300056857 Unclassified 31295
97 Ga0123353_10058850 3300010167 Bacteria 6159
98 Ga0466707_222809 3300042601 Bacteria 6983
99 Ga0466707_266046 3300042601 Bacteria 4953
100 Ga0466713_110889 3300042602 Bacteria 35385
101 Ga0160459_101917 3300012831 Bacteria 3821
102 Ga0160446_100403 3300012835 Bacteria 21084
103 Ga0160448_100116 3300012854 Bacteria 38451
104 Ga0160436_1000222 3300012861 Bacteria 27741
105 Ga0466696_320963 3300042596 Bacteria 13939
106 Ga0466703_371370 3300042636 Bacteria 5830
107 CVPL010W_10015789 3300002931 Bacteria 5220
108 Ga0103261_1000334 3300007083 Unclassified 17818
109 Ga0123357_10000589 3300009784 Bacteria 35908
110 Ga0562378_1480 3300056814 Bacteria 25266
111 Ga0562376_6023 3300056857 Bacteria 6473
112 Ga0562374_2091 3300057007 Unclassified 19533
113 Ga0123356_10000068 3300010049 Bacteria 108740
114 Ga0123356_10000676 3300010049 Bacteria 37752
115 Ga0123354_10280765 3300010882 Bacteria 1618
116 Ga0160454_101101 3300012798 Unclassified 4578
117 Ga0160464_100237 3300012805 Bacteria 53498
118 Ga0466707_154911 3300042601 Bacteria 3274
119 Ga0466707_382854 3300042601 Bacteria 200054
120 Ga0466713_065581 3300042602 Bacteria 52137
121 Ga0160440_100073 3300012815 Bacteria 122713
122 Ga0160452_100205 3300012834 Bacteria 63686
123 Ga0160446_100323 3300012835 Bacteria 27155
124 Ga0160434_100541 3300012850 Bacteria 9675
125 Ga0466693_354246 3300042592 Bacteria 62518
126 Ga0466735_019925 3300042624 Bacteria 1338
127 Ga0466703_111323 3300042636 Bacteria 3747
128 Ga0466727_126145 3300042655 Bacteria 1361
129 Ga0103263_101306 3300007042 Bacteria 3244
130 Ga0103263_102980 3300007042 Bacteria 2051
131 Ga0103261_1008590 3300007083 Bacteria 2524
132 Ga0102739_1000277 3300007095 Bacteria 18512
133 Ga0103260_1001990 3300007139 Bacteria 3540
134 Ga0103260_1002154 3300007139 Bacteria 3378
135 Ga0102740_1001625 3300007140 Bacteria 5562
136 Ga0102738_1000064 3300007141 Bacteria 83878
137 Ga0466705_009364 3300042612 Bacteria 2029
138 Ga0562376_0008 3300056857 Bacteria 1266359
139 Ga0562376_1956 3300056857 Bacteria 26751
140 Ga0466718_142322 3300042617 Bacteria 6319
141 Ga0466706_166351 3300042599 Bacteria 10416
142 Ga0160431_101020 3300012828 Bacteria 8568
143 Ga0160459_102641 3300012831 Bacteria 2828
144 Ga0160444_100091 3300012841 Bacteria 113908
145 Ga0160430_102050 3300012852 Bacteria 6705
146 Ga0160457_1000008 3300012858 Bacteria 511605
147 Ga0466701_008647 3300042598 Bacteria 4182
148 Ga0466730_045706 3300042625 Bacteria 6018
149 Ga0466724_14614 3300042649 Bacteria 32602
150 Ga0466724_46140 3300042649 Bacteria 630192
151 JGI24699J35502_11133592 3300002509 Bacteria 12324
152 Ga0074278_136700 3300005721 Unclassified 6511
153 Ga0103261_1001571 3300007083 Bacteria 4215
154 Ga0102734_1000005 3300007129 Bacteria 74314
155 Ga0103268_1000170 3300007192 Bacteria 21581
156 Ga0562377_0007 3300056842 Bacteria 3019242
157 Ga0123357_10171976 3300009784 Bacteria 2559
158 Ga0123353_10000623 3300010167 Bacteria 43400
159 Ga0123354_10130970 3300010882 Bacteria 3168
160 Ga0123354_10231700 3300010882 Bacteria 1929
161 Ga0466707_114750 3300042601 Bacteria 67340
162 Ga0466713_122414 3300042602 Bacteria 2393
163 Ga0160468_100001 3300012819 Bacteria 1115787
164 Ga0160441_100734 3300012825 Bacteria 17925
165 Ga0160455_101722 3300012837 Bacteria 5770
166 Ga0160434_100070 3300012850 Bacteria 71817
167 Ga0160430_103391 3300012852 Bacteria 4423
168 Ga0160448_100147 3300012854 Bacteria 33346
169 Ga0160436_1000295 3300012861 Unclassified 22259
170 Ga0072940_1085735 3300005200 Bacteria 4630
171 Ga0102736_1000573 3300007052 Bacteria 7373
172 Ga0102739_1001658 3300007095 Bacteria 3628
173 Ga0102734_1001275 3300007129 Bacteria 9270
174 Ga0102734_1001865 3300007129 Bacteria 5109
175 Ga0102740_1000039 3300007140 Bacteria 31302
176 Ga0102737_1000497 3300007142 Bacteria 12806
177 Ga0104050_1200408 3300007153 Bacteria 2362
178 Ga0103268_1007513 3300007192 Bacteria 2227

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01063 Aminotran_4 Amino-transferase class IV 136 381 0.87

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF01063 GO:0003824 catalytic activity MF

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.