Protein Family IF01706
Metagenome
Isolate
205
Members
100
Samples
168
Scaffolds
381.63
Avg Length
Representative Sequence
- ID
- 3300007129|Ga0102734_1003772|Ga0102734_10037723
- Length
- 416 aa
- Sequence
- MNLEPFLQIMAERKAADLFIAAGFPPAAKIHGKLVPLTKAPLTEEQTRKAAYGIMTERQREEFDNSSECNFAIRSRAGRFRASAFIQQGSVSIVMRRIEEEIPNLEDLELPPIIQKLAMTRLGLILFVGGTGTGKSSSLAAMLGYRNQHSNGHIITIEDPIEFVHKHRNCIVNQREVGVDTESYDVALRNSLRQAPDVIMLGEIRSLKTMSYAMHFAESGHVCISTLHANSANQALERIINFFPADQKEQSLFDLSINLRAIIAQKLVPVKSGGRRAVIEIMLNTPLISDLIRKGEIADIKPIIAKSRTLGMQTFDQSLFALYKEDELTQEEAMSYADSPNDLRLMIKLDTDAGGEELKKAAEKFVLYQAPEEGEQKESGKISIKEMMKKSKSHNKGLAGIADNIKDLNITLADD*
Sample Types
Isolate
18.1%
Metagenome
82.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
25.0%
Unclassified
22.9%
Kalotermitidae
14.6%
Elmidae
12.5%
Formicidae
5.2%
Rhinotermitidae
4.2%
Termopsidae
4.2%
Culicidae
3.1%
Curculionidae
3.1%
Hydrophilidae
2.1%
Armadillidiidae
2.1%
Hodotermitidae
1.0%
Taxonomy
Archaea
0
Bacteria
197
Eukaryota
0
Viruses
0
Unclassified
8
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 2 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 3 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 4 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 5 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 6 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 7 | 2864826666 | Acidovorax konjaci S00067 | Isolate | Elmidae |
| 8 | 2873571580 | Diaphorobacter sp. HDW4B | Isolate | Hydrophilidae |
| 9 | 2820047982 | Unclassified Proteobacteria Th196P3bin67 | Isolate | Unclassified |
| 10 | 2820059968 | Unclassified Proteobacteria Nt197P4bin23 | Isolate | Unclassified |
| 11 | 2820131053 | Unclassified Proteobacteria Emb289P3bin8 | Isolate | Unclassified |
| 12 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 13 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 14 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 15 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 16 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 17 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 18 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 19 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 20 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 21 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 22 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 23 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 24 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 25 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 26 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 27 | 2864812326 | Chitinimonas taiwanensis S00057 | Isolate | Elmidae |
| 28 | 2864859030 | Chromobacterium alkanivorans S00115 | Isolate | Elmidae |
| 29 | 2864960361 | Comamonas odontotermitis S00229 | Isolate | Elmidae |
| 30 | 2868169047 | Comamonas aquatica S00077 | Isolate | Elmidae |
| 31 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 32 | 3300012809 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG | Metagenome | |
| 33 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 34 | 8100461708 | Delftia sp. S65 | Isolate | Curculionidae |
| 35 | 2864755708 | Massilia timonae S00006 | Isolate | Elmidae |
| 36 | 2820065746 | Unclassified Proteobacteria Nt197P3bin56 | Isolate | Unclassified |
| 37 | 2820084079 | Unclassified Proteobacteria Lab288P4bin103 | Isolate | Unclassified |
| 38 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 39 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 40 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 41 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 42 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 43 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 44 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 45 | 8100455565 | Delftia sp. S67 | Isolate | Curculionidae |
| 46 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 47 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 48 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 49 | 2864914039 | Chromobacterium alkanivorans S00172 | Isolate | Elmidae |
| 50 | 2864988360 | Chromobacterium alkanivorans S00296 | Isolate | Elmidae |
| 51 | 2820103659 | Unclassified Proteobacteria Emb289P4bin67 | Isolate | Unclassified |
| 52 | 2820121232 | Unclassified Proteobacteria Emb289P4bin32 | Isolate | Unclassified |
| 53 | 2820123897 | Unclassified Proteobacteria Emb289P4bin18 | Isolate | Unclassified |
| 54 | 2820164216 | Unclassified Proteobacteria Cu122P1bin22 | Isolate | Unclassified |
| 55 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 56 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 57 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 58 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 59 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 60 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 61 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 62 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 63 | 2864870719 | Comamonas odontotermitis S00124 | Isolate | Elmidae |
| 64 | 2864937364 | Acidovorax soli S00198 | Isolate | Elmidae |
| 65 | 2891720358 | Azoarcus nasutitermitis CC-YHH838 | Isolate | Unclassified |
| 66 | 2820042117 | Unclassified Proteobacteria Th196P4bin58 | Isolate | Unclassified |
| 67 | 2820050117 | Unclassified Proteobacteria Th196P3bin129 | Isolate | Unclassified |
| 68 | 2820086750 | Unclassified Proteobacteria Lab288P3bin98 | Isolate | Unclassified |
| 69 | 2820157249 | Unclassified Proteobacteria Cu122P4bin11 | Isolate | Unclassified |
| 70 | 2820161938 | Unclassified Proteobacteria Cu122P3bin14 | Isolate | Unclassified |
| 71 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 72 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 73 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 74 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 75 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 76 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 77 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 78 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 79 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 80 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 81 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 82 | 2864808494 | Chitinimonas taiwanensis S00056 | Isolate | Elmidae |
| 83 | 2571042003 | Stenoxybacter acetivorans DSM 19021 | Isolate | Rhinotermitidae |
| 84 | 2820062699 | Unclassified Proteobacteria Nt197P4bin15 | Isolate | Unclassified |
| 85 | 2820077244 | Unclassified Proteobacteria Lab288P4bin72 | Isolate | Unclassified |
| 86 | 2820152154 | Unclassified Proteobacteria Cu122P5bin47 | Isolate | Unclassified |
| 87 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 88 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 89 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 90 | 8100449422 | Delftia sp. S66 | Isolate | Curculionidae |
| 91 | 2864968865 | Paucibacter oligotrophus S00239 | Isolate | Elmidae |
| 92 | 2873565274 | Diaphorobacter sp. HDW4A | Isolate | Hydrophilidae |
| 93 | 2820089333 | Unclassified Proteobacteria Lab288P3bin88 | Isolate | Unclassified |
| 94 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 95 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 96 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 97 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 98 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 99 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 100 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123357_10094547 | 3300009784 | Unclassified | 3879 |
| 2 | Ga0123356_10013546 | 3300010049 | Bacteria | 7864 |
| 3 | Ga0466711_118320 | 3300042615 | Bacteria | 6218 |
| 4 | Ga0466711_501732 | 3300042615 | Bacteria | 3213 |
| 5 | Ga0466715_340002 | 3300042616 | Bacteria | 4969 |
| 6 | Ga0466657_004786 | 3300042582 | Bacteria | 6761 |
| 7 | Ga0466657_097439 | 3300042582 | Bacteria | 29468 |
| 8 | Ga0466657_227720 | 3300042582 | Bacteria | 11721 |
| 9 | JGI24705J35276_12234579 | 3300002504 | Bacteria | 5646 |
| 10 | Ga0102735_1000123 | 3300007080 | Bacteria | 20218 |
| 11 | Ga0466701_027330 | 3300042598 | Bacteria | 79527 |
| 12 | Ga0466701_039976 | 3300042598 | Bacteria | 327114 |
| 13 | Ga0466713_026884 | 3300042602 | Bacteria | 64226 |
| 14 | Ga0466729_229351 | 3300042621 | Bacteria | 5366 |
| 15 | Ga0466734_081323 | 3300042623 | Bacteria | 6770 |
| 16 | Ga0466734_141953 | 3300042623 | Bacteria | 1890 |
| 17 | Ga0466735_028014 | 3300042624 | Bacteria | 2168 |
| 18 | Ga0466703_341173 | 3300042636 | Bacteria | 4970 |
| 19 | Ga0466724_26857 | 3300042649 | Bacteria | 91347 |
| 20 | Ga0466708_077242 | 3300042652 | Bacteria | 14262 |
| 21 | Ga0466725_128406 | 3300042654 | Bacteria | 6224 |
| 22 | Ga0466697_255061 | 3300042611 | Bacteria | 3333 |
| 23 | Ga0123354_10000002 | 3300010882 | Bacteria | 317342 |
| 24 | Ga0466712_063124 | 3300042614 | Bacteria | 1415 |
| 25 | Ga0466711_384001 | 3300042615 | Bacteria | 14197 |
| 26 | Ga0466723_161728 | 3300042618 | Bacteria | 22290 |
| 27 | Ga0466728_134467 | 3300042620 | Bacteria | 20390 |
| 28 | Ga0466728_392551 | 3300042620 | Bacteria | 4827 |
| 29 | Ga0466657_120452 | 3300042582 | Bacteria | 2151 |
| 30 | Ga0466657_287738 | 3300042582 | Bacteria | 27899 |
| 31 | Ga0102734_1003772 | 3300007129 | Bacteria | 3856 |
| 32 | Ga0103268_1004392 | 3300007192 | Bacteria | 2867 |
| 33 | Ga0466707_364354 | 3300042601 | Bacteria | 1417 |
| 34 | Ga0466719_052539 | 3300042606 | Bacteria | 15950 |
| 35 | Ga0466719_449246 | 3300042606 | Bacteria | 3181 |
| 36 | Ga0466719_489382 | 3300042606 | Unclassified | 1776 |
| 37 | Ga0466722_094205 | 3300042609 | Bacteria | 2795 |
| 38 | Ga0466722_120794 | 3300042609 | Bacteria | 1882 |
| 39 | Ga0466697_053404 | 3300042611 | Bacteria | 1908 |
| 40 | Ga0466731_322894 | 3300042622 | Bacteria | 3440 |
| 41 | Ga0466734_010816 | 3300042623 | Bacteria | 2399 |
| 42 | Ga0466730_008869 | 3300042625 | Bacteria | 313970 |
| 43 | Ga0466703_011291 | 3300042636 | Bacteria | 72818 |
| 44 | Ga0466703_164149 | 3300042636 | Bacteria | 3094 |
| 45 | Ga0466709_149723 | 3300042648 | Bacteria | 12767 |
| 46 | Ga0123353_10162492 | 3300010167 | Bacteria | 3554 |
| 47 | Ga0160466_102546 | 3300012809 | Bacteria | 3520 |
| 48 | Ga0466710_095007 | 3300042613 | Bacteria | 4314 |
| 49 | Ga0466715_355522 | 3300042616 | Bacteria | 36627 |
| 50 | Ga0466729_053950 | 3300042621 | Bacteria | 6335 |
| 51 | Ga0160452_100138 | 3300012834 | Bacteria | 89167 |
| 52 | Ga0466692_032468 | 3300042591 | Bacteria | 5269 |
| 53 | Ga0466692_190209 | 3300042591 | Bacteria | 13472 |
| 54 | Ga0466695_287312 | 3300042595 | Bacteria | 4958 |
| 55 | Ga0068305_10272096 | 3300005083 | Bacteria | 1320 |
| 56 | Ga0072941_1029212 | 3300005201 | Bacteria | 3469 |
| 57 | Ga0466706_206485 | 3300042599 | Bacteria | 5606 |
| 58 | Ga0466700_062728 | 3300042600 | Bacteria | 2041 |
| 59 | Ga0466707_073003 | 3300042601 | Bacteria | 1602 |
| 60 | Ga0466717_230984 | 3300042604 | Bacteria | 7136 |
| 61 | Ga0466716_040701 | 3300042605 | Bacteria | 7384 |
| 62 | Ga0466722_154034 | 3300042609 | Bacteria | 3068 |
| 63 | Ga0466722_261346 | 3300042609 | Bacteria | 18889 |
| 64 | Ga0466708_397330 | 3300042652 | Bacteria | 3215 |
| 65 | Ga0466727_195436 | 3300042655 | Bacteria | 5829 |
| 66 | Ga0466733_178438 | 3300042659 | Bacteria | 4867 |
| 67 | Ga0466726_053798 | 3300042619 | Bacteria | 5537 |
| 68 | Ga0160472_103641 | 3300012839 | Bacteria | 2968 |
| 69 | Ga0160447_107668 | 3300012849 | Bacteria | 2669 |
| 70 | Ga0466690_099297 | 3300042590 | Bacteria | 8294 |
| 71 | Ga0466693_084945 | 3300042592 | Bacteria | 2581 |
| 72 | Ga0466691_023612 | 3300042593 | Bacteria | 17170 |
| 73 | Ga0466691_032545 | 3300042593 | Bacteria | 5119 |
| 74 | Ga0103267_1001501 | 3300007190 | Bacteria | 5809 |
| 75 | Ga0466701_018022 | 3300042598 | Bacteria | 1893 |
| 76 | Ga0466707_209029 | 3300042601 | Bacteria | 4552 |
| 77 | Ga0466707_293290 | 3300042601 | Bacteria | 6686 |
| 78 | Ga0466716_346187 | 3300042605 | Bacteria | 2974 |
| 79 | Ga0466719_116381 | 3300042606 | Bacteria | 6101 |
| 80 | Ga0466719_546594 | 3300042606 | Bacteria | 14451 |
| 81 | Ga0466703_006343 | 3300042636 | Bacteria | 1729 |
| 82 | Ga0466704_132280 | 3300042643 | Bacteria | 33822 |
| 83 | Ga0466725_127442 | 3300042654 | Bacteria | 7081 |
| 84 | Ga0466725_375239 | 3300042654 | Bacteria | 27664 |
| 85 | Ga0466697_122255 | 3300042611 | Bacteria | 3971 |
| 86 | Ga0466705_105450 | 3300042612 | Bacteria | 12741 |
| 87 | Ga0466732_094350 | 3300042656 | Bacteria | 2842 |
| 88 | Ga0466710_029876 | 3300042613 | Bacteria | 3705 |
| 89 | Ga0466710_146058 | 3300042613 | Bacteria | 18610 |
| 90 | Ga0466712_041405 | 3300042614 | Bacteria | 4759 |
| 91 | Ga0466715_249410 | 3300042616 | Bacteria | 31894 |
| 92 | Ga0466723_100869 | 3300042618 | Bacteria | 18431 |
| 93 | Ga0160455_100051 | 3300012837 | Bacteria | 249063 |
| 94 | Ga0466657_248399 | 3300042582 | Bacteria | 9181 |
| 95 | Ga0466657_272357 | 3300042582 | Bacteria | 12531 |
| 96 | Ga0466657_296952 | 3300042582 | Bacteria | 25234 |
| 97 | Ga0466690_012085 | 3300042590 | Bacteria | 20404 |
| 98 | JGI24702J35022_10000628 | 3300002462 | Bacteria | 21521 |
| 99 | Ga0123357_10000009 | 3300009784 | Bacteria | 204245 |
| 100 | Ga0466701_029854 | 3300042598 | Bacteria | 12533 |
| 101 | Ga0466719_558241 | 3300042606 | Bacteria | 1582 |
| 102 | Ga0466729_285013 | 3300042621 | Bacteria | 2822 |
| 103 | Ga0466734_080560 | 3300042623 | Bacteria | 12255 |
| 104 | Ga0466734_103526 | 3300042623 | Unclassified | 87559 |
| 105 | Ga0466730_086547 | 3300042625 | Bacteria | 310448 |
| 106 | Ga0466703_313613 | 3300042636 | Unclassified | 1782 |
| 107 | Ga0466709_369313 | 3300042648 | Bacteria | 5684 |
| 108 | Ga0466708_158547 | 3300042652 | Bacteria | 10728 |
| 109 | Ga0466725_409024 | 3300042654 | Bacteria | 23019 |
| 110 | Ga0466705_084923 | 3300042612 | Bacteria | 13395 |
| 111 | Ga0123354_10104192 | 3300010882 | Bacteria | 3807 |
| 112 | Ga0466710_075596 | 3300042613 | Bacteria | 4332 |
| 113 | Ga0466710_091764 | 3300042613 | Bacteria | 10549 |
| 114 | Ga0466726_248809 | 3300042619 | Bacteria | 15197 |
| 115 | Ga0160468_100534 | 3300012819 | Bacteria | 14896 |
| 116 | Ga0160472_101561 | 3300012839 | Bacteria | 6461 |
| 117 | Ga0466692_124694 | 3300042591 | Bacteria | 12687 |
| 118 | Ga0466695_055939 | 3300042595 | Bacteria | 12334 |
| 119 | Ga0466696_016270 | 3300042596 | Bacteria | 6053 |
| 120 | Ga0466701_000899 | 3300042598 | Bacteria | 4630 |
| 121 | Ga0466701_004422 | 3300042598 | Bacteria | 11947 |
| 122 | JGI24705J35276_12238748 | 3300002504 | Bacteria | 51303 |
| 123 | Ga0103264_1000228 | 3300007188 | Bacteria | 54643 |
| 124 | Ga0123357_10000446 | 3300009784 | Bacteria | 39827 |
| 125 | Ga0466707_175155 | 3300042601 | Bacteria | 29163 |
| 126 | Ga0466707_237624 | 3300042601 | Bacteria | 3697 |
| 127 | Ga0466717_102427 | 3300042604 | Bacteria | 13013 |
| 128 | Ga0466719_185332 | 3300042606 | Bacteria | 2807 |
| 129 | Ga0466697_030720 | 3300042611 | Bacteria | 6724 |
| 130 | Ga0466724_27476 | 3300042649 | Bacteria | 555291 |
| 131 | Ga0466708_092921 | 3300042652 | Bacteria | 15843 |
| 132 | Ga0466708_138327 | 3300042652 | Bacteria | 16274 |
| 133 | Ga0466708_212407 | 3300042652 | Bacteria | 33471 |
| 134 | Ga0466733_208575 | 3300042659 | Bacteria | 5904 |
| 135 | Ga0123353_10000514 | 3300010167 | Bacteria | 47868 |
| 136 | Ga0123354_10011126 | 3300010882 | Bacteria | 13885 |
| 137 | Ga0123354_10046483 | 3300010882 | Bacteria | 6630 |
| 138 | Ga0466715_144729 | 3300042616 | Bacteria | 1378 |
| 139 | Ga0160459_100048 | 3300012831 | Bacteria | 189455 |
| 140 | Ga0466692_167406 | 3300042591 | Bacteria | 107532 |
| 141 | JGI24702J35022_10030939 | 3300002462 | Bacteria | 2870 |
| 142 | Ga0466717_045276 | 3300042604 | Bacteria | 2180 |
| 143 | Ga0466717_302216 | 3300042604 | Bacteria | 6416 |
| 144 | Ga0466722_037049 | 3300042609 | Bacteria | 7525 |
| 145 | Ga0466722_179047 | 3300042609 | Bacteria | 2000 |
| 146 | Ga0466703_320420 | 3300042636 | Bacteria | 23900 |
| 147 | Ga0466703_431331 | 3300042636 | Unclassified | 4185 |
| 148 | Ga0466709_408176 | 3300042648 | Bacteria | 55853 |
| 149 | Ga0466708_039324 | 3300042652 | Bacteria | 18031 |
| 150 | Ga0466708_400330 | 3300042652 | Bacteria | 6857 |
| 151 | Ga0466725_003617 | 3300042654 | Bacteria | 5537 |
| 152 | Ga0466725_195637 | 3300042654 | Bacteria | 58825 |
| 153 | Ga0123356_10005504 | 3300010049 | Bacteria | 12887 |
| 154 | Ga0466710_249192 | 3300042613 | Bacteria | 63183 |
| 155 | Ga0466715_036071 | 3300042616 | Bacteria | 24043 |
| 156 | Ga0466729_016426 | 3300042621 | Bacteria | 23520 |
| 157 | Ga0160430_101264 | 3300012852 | Unclassified | 9819 |
| 158 | Ga0466657_160367 | 3300042582 | Bacteria | 1702 |
| 159 | Ga0466690_210430 | 3300042590 | Bacteria | 39724 |
| 160 | Ga0466694_407445 | 3300042594 | Bacteria | 4439 |
| 161 | JGI24696J40584_12936920 | 3300002834 | Unclassified | 1591 |
| 162 | Ga0068302_10156433 | 3300005071 | Bacteria | 3071 |
| 163 | Ga0072941_1029213 | 3300005201 | Unclassified | 6848 |
| 164 | Ga0123357_10001248 | 3300009784 | Bacteria | 26720 |
| 165 | Ga0466701_057210 | 3300042598 | Bacteria | 6983 |
| 166 | Ga0466719_145905 | 3300042606 | Bacteria | 12080 |
| 167 | Ga0466704_305396 | 3300042643 | Bacteria | 13952 |
| 168 | Ga0466727_179157 | 3300042655 | Bacteria | 29827 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00437 | T2SSE | Type II/IV secretion system protein | 71 | 269 | 0.83 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.