Protein Family IF01377

Metagenome Isolate
120 Members
37 Samples
118 Scaffolds
87.99 Avg Length

🧬 Representative Sequence

ID
3300005201|Ga0072941_1396684|Ga0072941_13966842
Length
89 aa
Sequence
MRVISIKDMIRKDVPIYYRNLYTGVAVIEVPKKGAENYRIDFAIECKPTGHKEISVTFIDKVDYPLVPLNKELKQFIENLHDQGGLPE*

📊 Sample Types

Isolate 1.7%
Metagenome 98.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 62.9%
Kalotermitidae 20.0%
Rhinotermitidae 8.6%
Unclassified 8.6%

🌳 Taxonomy

Archaea 0
Bacteria 104
Eukaryota 0
Viruses 0
Unclassified 16

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
2 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
3 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
4 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
5 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
6 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
7 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
8 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
9 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
10 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
11 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
12 2781125636 Treponema sp. Co191P1bin67 Isolate Unclassified
13 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
14 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
15 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
16 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
17 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
18 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
19 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
20 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
21 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
22 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
23 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
24 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
25 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
26 2781125660 Treponema sp. Emb289P3bin52 Isolate Unclassified
27 2228664002 P3 Gut Segment Termite Single Cell Genome_Treponema sp. T3a from Florida, USA Metagenome Termitidae
28 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
29 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
30 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
31 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
32 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
33 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
34 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
35 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
36 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
37 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466700_023427 3300042600 Bacteria 1182
2 Ga0466720_122526 3300042607 Bacteria 10507
3 Ga0466720_192205 3300042607 Bacteria 27673
4 Ga0466722_148024 3300042609 Bacteria 3933
5 JGI24698J34947_10052004 3300002449 Bacteria 2057
6 Ga0072940_1341841 3300005200 Bacteria 1578
7 Ga0264413_109017 3300024493 Unclassified 3493
8 Ga0466692_171000 3300042591 Bacteria 3500
9 Ga0466731_434279 3300042622 Bacteria 4438
10 Ga0466725_356813 3300042654 Bacteria 1453
11 Ga0123356_13732611 3300010049 Bacteria 526
12 Ga0123353_12146567 3300010167 Bacteria 678
13 Ga0466717_099552 3300042604 Unclassified 1001
14 Ga0466720_026749 3300042607 Bacteria 6005
15 Ga0466720_040292 3300042607 Bacteria 2749
16 Ga0466720_099022 3300042607 Unclassified 10951
17 Ga0466720_148028 3300042607 Bacteria 1344
18 Ga0466722_155897 3300042609 Bacteria 8113
19 AustNasuHG_c1000091 3300000089 Bacteria 26251
20 AustNasuHG_c1001704 3300000089 Bacteria 7939
21 AustNasuHG_c1079524 3300000089 Unclassified 559
22 Ga0072940_1013883 3300005200 Bacteria 28643
23 Ga0466718_120534 3300042617 Bacteria 8943
24 Ga0466718_146062 3300042617 Bacteria 2478
25 Ga0264413_104625 3300024493 Bacteria 6859
26 Ga0264413_110087 3300024493 Unclassified 6041
27 Ga0264413_113835 3300024493 Bacteria 5230
28 Ga0466694_184864 3300042594 Bacteria 6042
29 Ga0466695_015371 3300042595 Bacteria 19512
30 Ga0466702_226988 3300042635 Bacteria 3073
31 Ga0466732_221015 3300042656 Bacteria 3057
32 Ga0123356_12955397 3300010049 Bacteria 594
33 Ga0466720_006284 3300042607 Bacteria 19291
34 Ga0466722_088486 3300042609 Bacteria 1472
35 AustNasuHG_c1013489 3300000089 Unclassified 2800
36 AustNasuHG_c1052276 3300000089 Unclassified 861
37 JGI24698J34947_10001606 3300002449 Bacteria 12017
38 JGI24695J34938_10002867 3300002450 Bacteria 12563
39 Ga0264413_106621 3300024493 Bacteria 23503
40 Ga0466699_378081 3300042597 Bacteria 3199
41 Ga0466702_024424 3300042635 Bacteria 4693
42 Ga0466703_037720 3300042636 Bacteria 12133
43 Ga0466705_331480 3300042612 Bacteria 1720
44 Ga0466732_054620 3300042656 Bacteria 2138
45 Ga0123356_10023685 3300010049 Unclassified 5776
46 Ga0466717_075250 3300042604 Bacteria 1119
47 Ga0466719_045447 3300042606 Bacteria 2050
48 Ga0466722_096561 3300042609 Bacteria 1099
49 JGI24695J34938_10000883 3300002450 Bacteria 27695
50 Ga0072941_1396684 3300005201 Bacteria 569
51 Ga0466704_385519 3300042643 Bacteria 14620
52 Ga0466732_081167 3300042656 Bacteria 6671
53 Ga0123356_10389048 3300010049 Bacteria 1529
54 Ga0123353_10450219 3300010167 Bacteria 1896
55 Ga0123353_11614578 3300010167 Bacteria 818
56 AustNasuHG_c1012779 3300000089 Bacteria 2893
57 AustNasuHG_c1041042 3300000089 Bacteria 1121
58 Ga0072940_1040842 3300005200 Bacteria 1238
59 Ga0074263_118754 3300005485 Unclassified 1516
60 Ga0466712_233820 3300042614 Bacteria 43972
61 Ga0466718_016271 3300042617 Bacteria 23380
62 Ga0466718_039529 3300042617 Unclassified 1093
63 Ga0466718_120957 3300042617 Bacteria 20111
64 Ga0466694_111575 3300042594 Bacteria 4210
65 Ga0466694_149179 3300042594 Bacteria 1329
66 Ga0466694_300400 3300042594 Bacteria 1073
67 Ga0466694_316805 3300042594 Bacteria 1521
68 Ga0466704_045261 3300042643 Bacteria 9512
69 Ga0466732_155889 3300042656 Bacteria 4630
70 Ga0123353_10868679 3300010167 Bacteria 1233
71 Ga0466713_124156 3300042602 Bacteria 1155
72 Ga0466716_195867 3300042605 Bacteria 19936
73 Ga0466720_073219 3300042607 Bacteria 29974
74 Ga0466722_100100 3300042609 Bacteria 1908
75 Ga0466722_246200 3300042609 Bacteria 4552
76 Ga0466722_262104 3300042609 Bacteria 4335
77 AustNasuHG_c1026928 3300000089 Bacteria 1775
78 JGI24695J34938_10000167 3300002450 Bacteria 61547
79 Ga0072940_1004832 3300005200 Bacteria 5412
80 Ga0072940_1045848 3300005200 Bacteria 14773
81 Ga0072941_1630588 3300005201 Bacteria 742
82 Ga0466712_033790 3300042614 Bacteria 23879
83 Ga0466712_157527 3300042614 Bacteria 16242
84 Ga0466718_142424 3300042617 Bacteria 2595
85 Ga0466729_105046 3300042621 Bacteria 1311
86 Ga0415639_136028 3300038395 Bacteria 1752
87 Ga0466693_254839 3300042592 Bacteria 37752
88 Ga0466691_019077 3300042593 Bacteria 3284
89 Ga0466699_400493 3300042597 Bacteria 1672
90 Ga0466732_319378 3300042656 Unclassified 1431
91 Ga0123356_10000078 3300010049 Bacteria 103379
92 Ga0466720_050207 3300042607 Bacteria 2610
93 Ga0466720_098555 3300042607 Bacteria 28743
94 2230941960 2228664002 Unclassified 2218
95 JGI24695J34938_10000309 3300002450 Bacteria 48089
96 JGI24695J34938_10000832 3300002450 Bacteria 28661
97 Ga0072941_1396686 3300005201 Unclassified 548
98 Ga0074263_139299 3300005485 Unclassified 777
99 Ga0466705_414422 3300042612 Bacteria 10435
100 Ga0466718_026951 3300042617 Bacteria 14392
101 Ga0466699_227319 3300042597 Bacteria 1151
102 Ga0466702_205978 3300042635 Bacteria 1354
103 Ga0466708_194348 3300042652 Bacteria 3108
104 Ga0466732_310491 3300042656 Bacteria 10441
105 Ga0123353_11263255 3300010167 Bacteria 962
106 Ga0466700_073794 3300042600 Bacteria 1516
107 Ga0466700_245234 3300042600 Bacteria 1619
108 Ga0466719_263457 3300042606 Bacteria 8892
109 Ga0466720_106983 3300042607 Bacteria 9746
110 AustNasuHG_c1001438 3300000089 Bacteria 8525
111 JGI24695J34938_10000012 3300002450 Bacteria 126955
112 JGI24695J34938_10011364 3300002450 Bacteria 4799
113 Ga0466718_083344 3300042617 Bacteria 41687
114 Ga0466718_099749 3300042617 Bacteria 8394
115 Ga0264413_109932 3300024493 Unclassified 8014
116 Ga0466694_092283 3300042594 Bacteria 41988
117 Ga0466694_120398 3300042594 Unclassified 2649
118 Ga0466702_208670 3300042635 Bacteria 1238

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042609 Ga0466722_088486 Ga0466722_088486_732_971 79
2 3300005201 Ga0072941_1630588 Ga0072941_16305882 85
3 2228664002 2230941960 2230643942 87
4 3300024493 Ga0264413_104625 Ga0264413_1046253 87
5 3300024493 Ga0264413_106621 Ga0264413_10662112 87
6 3300024493 Ga0264413_109017 Ga0264413_1090172 87
7 3300024493 Ga0264413_109932 Ga0264413_1099324 87
8 3300024493 Ga0264413_110087 Ga0264413_1100876 87
9 3300024493 Ga0264413_113835 Ga0264413_1138355 87
10 3300038395 Ga0415639_136028 Ga0415639_136028_1194_1457 87
11 3300042591 Ga0466692_171000 Ga0466692_171000_622_885 87
12 3300042593 Ga0466691_019077 Ga0466691_019077_2611_2874 87
13 3300042594 Ga0466694_092283 Ga0466694_092283_11208_11471 87
14 3300042594 Ga0466694_111575 Ga0466694_111575_1879_2142 87
15 3300042594 Ga0466694_120398 Ga0466694_120398_273_536 87
16 3300042594 Ga0466694_149179 Ga0466694_149179_356_619 87
17 3300042594 Ga0466694_184864 Ga0466694_184864_930_1193 87
18 3300042594 Ga0466694_300400 Ga0466694_300400_351_614 87
19 3300042595 Ga0466695_015371 Ga0466695_015371_15101_15364 87
20 3300042597 Ga0466699_227319 Ga0466699_227319_761_1024 87
21 3300042597 Ga0466699_378081 Ga0466699_378081_2340_2603 87
22 3300042600 Ga0466700_023427 Ga0466700_023427_668_931 87
23 3300042600 Ga0466700_073794 Ga0466700_073794_776_1039 87
24 3300042600 Ga0466700_245234 Ga0466700_245234_1302_1565 87
25 3300042602 Ga0466713_124156 Ga0466713_124156_459_722 87
26 3300042604 Ga0466717_075250 Ga0466717_075250_598_861 87
27 3300042604 Ga0466717_099552 Ga0466717_099552_82_345 87
28 3300042605 Ga0466716_195867 Ga0466716_195867_12330_12593 87
29 3300042606 Ga0466719_045447 Ga0466719_045447_253_516 87
30 3300042606 Ga0466719_263457 Ga0466719_263457_2652_2915 87
31 3300042607 Ga0466720_006284 Ga0466720_006284_14926_15189 87
32 3300042607 Ga0466720_026749 Ga0466720_026749_806_1069 87
33 3300042607 Ga0466720_073219 Ga0466720_073219_22713_22976 87
34 3300042607 Ga0466720_098555 Ga0466720_098555_21823_22086 87
35 3300042607 Ga0466720_099022 Ga0466720_099022_6536_6799 87
36 3300042607 Ga0466720_106983 Ga0466720_106983_5404_5667 87
37 3300042607 Ga0466720_192205 Ga0466720_192205_20531_20794 87
38 3300042609 Ga0466722_096561 Ga0466722_096561_108_371 87
39 3300042609 Ga0466722_100100 Ga0466722_100100_262_525 87
40 3300042609 Ga0466722_148024 Ga0466722_148024_2765_3028 87
41 3300042609 Ga0466722_155897 Ga0466722_155897_2120_2383 87
42 3300042609 Ga0466722_246200 Ga0466722_246200_787_1050 87
43 3300042609 Ga0466722_262104 Ga0466722_262104_3533_3796 87
44 3300042612 Ga0466705_331480 Ga0466705_331480_418_681 87
45 3300042612 Ga0466705_414422 Ga0466705_414422_8136_8399 87
46 3300042614 Ga0466712_033790 Ga0466712_033790_17598_17861 87
47 3300042614 Ga0466712_157527 Ga0466712_157527_10405_10668 87
48 3300042614 Ga0466712_233820 Ga0466712_233820_18611_18874 87
49 3300042617 Ga0466718_016271 Ga0466718_016271_6433_6696 87
50 3300042617 Ga0466718_026951 Ga0466718_026951_8677_8940 87
51 3300042617 Ga0466718_083344 Ga0466718_083344_6617_6880 87
52 3300042617 Ga0466718_099749 Ga0466718_099749_7577_7840 87
53 3300042617 Ga0466718_120534 Ga0466718_120534_4676_4939 87
54 3300042617 Ga0466718_120957 Ga0466718_120957_13244_13507 87
55 3300042621 Ga0466729_105046 Ga0466729_105046_501_764 87
56 3300042635 Ga0466702_024424 Ga0466702_024424_642_905 87
57 3300042635 Ga0466702_205978 Ga0466702_205978_1081_1344 87
58 3300042635 Ga0466702_208670 Ga0466702_208670_775_1038 87
59 3300042635 Ga0466702_226988 Ga0466702_226988_1056_1319 87
60 3300042636 Ga0466703_037720 Ga0466703_037720_3396_3659 87
61 3300042643 Ga0466704_045261 Ga0466704_045261_5235_5498 87
62 3300042643 Ga0466704_385519 Ga0466704_385519_8021_8284 87
63 3300042652 Ga0466708_194348 Ga0466708_194348_850_1113 87
64 3300042654 Ga0466725_356813 Ga0466725_356813_880_1143 87
65 3300042656 Ga0466732_054620 Ga0466732_054620_1358_1621 87
66 3300042656 Ga0466732_221015 Ga0466732_221015_2037_2300 87
67 3300042656 Ga0466732_310491 Ga0466732_310491_5822_6085 87
68 3300042656 Ga0466732_319378 Ga0466732_319378_466_729 87
69 iso_pr_bacteria 2781125636 2781279577 87
70 iso_pr_bacteria 2781125660 2781330786 87
71 3300000089 AustNasuHG_c1000091 AustNasuHG_100009117 88
72 3300000089 AustNasuHG_c1001438 AustNasuHG_10014386 88
73 3300000089 AustNasuHG_c1012779 AustNasuHG_10127792 88
74 3300000089 AustNasuHG_c1013489 AustNasuHG_10134894 88
75 3300000089 AustNasuHG_c1026928 AustNasuHG_10269282 88
76 3300000089 AustNasuHG_c1041042 AustNasuHG_10410422 88
77 3300000089 AustNasuHG_c1052276 AustNasuHG_10522762 88
78 3300000089 AustNasuHG_c1079524 AustNasuHG_10795242 88
79 3300002449 JGI24698J34947_10001606 JGI24698J34947_100016067 88
80 3300002449 JGI24698J34947_10052004 JGI24698J34947_100520043 88
81 3300002450 JGI24695J34938_10000309 JGI24695J34938_100003098 88
82 3300002450 JGI24695J34938_10000832 JGI24695J34938_100008328 88
83 3300002450 JGI24695J34938_10000883 JGI24695J34938_100008836 88
84 3300002450 JGI24695J34938_10002867 JGI24695J34938_100028678 88
85 3300002450 JGI24695J34938_10011364 JGI24695J34938_100113642 88
86 3300005200 Ga0072940_1004832 Ga0072940_10048323 88
87 3300005200 Ga0072940_1013883 Ga0072940_101388322 88
88 3300005200 Ga0072940_1040842 Ga0072940_10408422 88
89 3300005200 Ga0072940_1045848 Ga0072940_10458489 88
90 3300005200 Ga0072940_1341841 Ga0072940_13418413 88
91 3300005201 Ga0072941_1396686 Ga0072941_13966862 88
92 3300005485 Ga0074263_118754 Ga0074263_1187542 88
93 3300010049 Ga0123356_10000078 Ga0123356_1000007869 88
94 3300010049 Ga0123356_10389048 Ga0123356_103890482 88
95 3300010049 Ga0123356_13732611 Ga0123356_137326111 88
96 3300010167 Ga0123353_10450219 Ga0123353_104502192 88
97 3300010167 Ga0123353_10868679 Ga0123353_108686792 88
98 3300010167 Ga0123353_11263255 Ga0123353_112632552 88
99 3300010167 Ga0123353_11614578 Ga0123353_116145782 88
100 3300010167 Ga0123353_12146567 Ga0123353_121465672 88
101 3300042607 Ga0466720_122526 Ga0466720_122526_5499_5765 88
102 3300002450 JGI24695J34938_10000012 JGI24695J34938_1000001258 89
103 3300005201 Ga0072941_1396684 Ga0072941_13966842 89
104 3300005485 Ga0074263_139299 Ga0074263_1392991 89
105 3300010049 Ga0123356_12955397 Ga0123356_129553972 89
106 3300042592 Ga0466693_254839 Ga0466693_254839_11761_12030 89
107 3300002450 JGI24695J34938_10000167 JGI24695J34938_1000016716 90
108 3300042607 Ga0466720_040292 Ga0466720_040292_1357_1629 90
109 3300042607 Ga0466720_050207 Ga0466720_050207_539_811 90
110 3300042607 Ga0466720_148028 Ga0466720_148028_699_971 90
111 3300042617 Ga0466718_142424 Ga0466718_142424_154_426 90
112 3300042617 Ga0466718_146062 Ga0466718_146062_1771_2043 90
113 3300042622 Ga0466731_434279 Ga0466731_434279_1979_2251 90
114 3300042656 Ga0466732_081167 Ga0466732_081167_5915_6187 90
115 3300010049 Ga0123356_10023685 Ga0123356_100236857 91
116 3300042617 Ga0466718_039529 Ga0466718_039529_625_909 94
117 3300042656 Ga0466732_155889 Ga0466732_155889_4097_4381 94
118 3300042597 Ga0466699_400493 Ga0466699_400493_745_1041 98
119 3300042594 Ga0466694_316805 Ga0466694_316805_24_335 103
120 3300000089 AustNasuHG_c1001704 AustNasuHG_10017047 106

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.82 0.82 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.