Protein Family IF01328
Metagenome
Isolate
143
Members
39
Samples
132
Scaffolds
457.83
Avg Length
Representative Sequence
- ID
- 3300005201|Ga0072941_1056650|Ga0072941_10566503
- Length
- 459 aa
- Sequence
- MDRVDFKILWDKTLDLLKLELGEDVFGGWFTDIRYLKSEENRIYIGFPSAFYLDRVKTLYQKTISAKLKELQGEEISLEFEVIPGNETKDADTERKKPADTNIVTANGKPDDISTEKKEEKPAVKQNKKKHPQLRDDFTFEKYVIGENNNFAANAAMAISTNPGTTHNPFFIYGGVGLGKTHLMQAIGNYIHENSDNKVICVTSEDFLNEYLLALKDREMPAFKNRFRYTDVLLIDDIQFFQEKEGVQEEFFHTFNQLIGAKKQIVMTCDRPPFELKKISDRLVSRFEQGIRADLQPPRYEVPDEVIDLVGKNISSNVRDLIGALNTLIAYTEIMGKSITLDIAQQKLRDVFASRRQANLSIETIQKVVTDFYNLSSNDLKGRKRNQKIVYPRQIAMYICRELTDYSTTEIGEAFGGRDHSTVMHSTEKIQDLLITDPSLDSTIENLKRQIKELSAKS*
Sample Types
Isolate
7.7%
Metagenome
92.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
51.4%
Unclassified
27.0%
Kalotermitidae
13.5%
Rhinotermitidae
5.4%
Termopsidae
2.7%
Taxonomy
Archaea
0
Bacteria
137
Eukaryota
0
Viruses
0
Unclassified
6
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 2 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 3 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 4 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 5 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 6 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 7 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 8 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 9 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 10 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 11 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 12 | 2781125646 | Treponema sp. Co191P3bin59 | Isolate | Unclassified |
| 13 | 2781125692 | Treponema sp. Th196P3bin31 | Isolate | Unclassified |
| 14 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 15 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 16 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 17 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 18 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 19 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 20 | 2781125635 | Treponema sp. Co191P1bin60 | Isolate | Unclassified |
| 21 | 2781125689 | Treponema sp. Mp193P4bin9 | Isolate | Unclassified |
| 22 | 2820020240 | Unclassified Spirochaetes Nc150P3bin10 | Isolate | Unclassified |
| 23 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 24 | 2781125631 | Treponema sp. Nt197P3bin89 | Isolate | Unclassified |
| 25 | 2781125645 | Treponema sp. Co191P3bin32 | Isolate | Unclassified |
| 26 | 2781125656 | Treponema sp. Emb289P1bin65 | Isolate | Unclassified |
| 27 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 28 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 29 | 2781125696 | Treponema sp. Th196P4bin22 | Isolate | Unclassified |
| 30 | 2819992462 | Unclassified Spirochaetes Nc150P4bin14 | Isolate | Unclassified |
| 31 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 32 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 33 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 34 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 35 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 36 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 37 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 38 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 39 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_326301 | 3300042656 | Bacteria | 7632 |
| 2 | Ga0466731_111941 | 3300042622 | Bacteria | 8493 |
| 3 | Ga0466712_019351 | 3300042614 | Unclassified | 2494 |
| 4 | Ga0466712_060791 | 3300042614 | Unclassified | 3968 |
| 5 | Ga0466712_083061 | 3300042614 | Bacteria | 9961 |
| 6 | Ga0466712_198445 | 3300042614 | Bacteria | 3342 |
| 7 | Ga0466711_066804 | 3300042615 | Bacteria | 6745 |
| 8 | Ga0264413_109344 | 3300024493 | Bacteria | 3516 |
| 9 | Ga0264413_109565 | 3300024493 | Bacteria | 11496 |
| 10 | Ga0466694_219378 | 3300042594 | Bacteria | 5049 |
| 11 | Ga0466694_237342 | 3300042594 | Bacteria | 9829 |
| 12 | Ga0466699_009862 | 3300042597 | Bacteria | 72863 |
| 13 | Ga0466699_228986 | 3300042597 | Bacteria | 3450 |
| 14 | AustNasuHG_c1000826 | 3300000089 | Bacteria | 11129 |
| 15 | JGI24698J34947_10002576 | 3300002449 | Bacteria | 9788 |
| 16 | JGI24698J34947_10021402 | 3300002449 | Bacteria | 3479 |
| 17 | Ga0123353_10002833 | 3300010167 | Bacteria | 21676 |
| 18 | Ga0466712_063145 | 3300042614 | Bacteria | 7233 |
| 19 | Ga0466712_146325 | 3300042614 | Bacteria | 3734 |
| 20 | Ga0466712_204472 | 3300042614 | Bacteria | 4223 |
| 21 | Ga0466712_291651 | 3300042614 | Bacteria | 3962 |
| 22 | Ga0466692_060721 | 3300042591 | Bacteria | 15119 |
| 23 | Ga0466694_107279 | 3300042594 | Bacteria | 1745 |
| 24 | Ga0466694_196391 | 3300042594 | Bacteria | 4503 |
| 25 | Ga0466694_253043 | 3300042594 | Bacteria | 3529 |
| 26 | Ga0466699_020661 | 3300042597 | Bacteria | 15510 |
| 27 | Ga0466699_284827 | 3300042597 | Bacteria | 14833 |
| 28 | JGI24698J34947_10004438 | 3300002449 | Bacteria | 7638 |
| 29 | JGI24698J34947_10013159 | 3300002449 | Unclassified | 4521 |
| 30 | JGI24698J34947_10018668 | 3300002449 | Bacteria | 3745 |
| 31 | JGI24695J34938_10001820 | 3300002450 | Bacteria | 17418 |
| 32 | JGI24702J35022_10006000 | 3300002462 | Bacteria | 7056 |
| 33 | Ga0072941_1043397 | 3300005201 | Bacteria | 2214 |
| 34 | Ga0072941_1043782 | 3300005201 | Bacteria | 4439 |
| 35 | Ga0466717_027003 | 3300042604 | Bacteria | 2425 |
| 36 | Ga0466722_167867 | 3300042609 | Bacteria | 10216 |
| 37 | Ga0466712_003015 | 3300042614 | Bacteria | 4821 |
| 38 | Ga0466712_074761 | 3300042614 | Bacteria | 3223 |
| 39 | Ga0466712_100129 | 3300042614 | Bacteria | 8525 |
| 40 | Ga0466718_011064 | 3300042617 | Bacteria | 26269 |
| 41 | Ga0466718_057300 | 3300042617 | Bacteria | 23198 |
| 42 | Ga0264413_113668 | 3300024493 | Bacteria | 13305 |
| 43 | Ga0466692_001256 | 3300042591 | Bacteria | 23042 |
| 44 | Ga0466694_257739 | 3300042594 | Bacteria | 1668 |
| 45 | Ga0466694_333017 | 3300042594 | Bacteria | 9653 |
| 46 | Ga0466699_000655 | 3300042597 | Bacteria | 10504 |
| 47 | Ga0466699_029059 | 3300042597 | Bacteria | 4296 |
| 48 | Ga0466699_142108 | 3300042597 | Bacteria | 2770 |
| 49 | Ga0466699_431883 | 3300042597 | Bacteria | 26603 |
| 50 | JGI24698J34947_10010274 | 3300002449 | Bacteria | 5131 |
| 51 | JGI24698J34947_10011807 | 3300002449 | Bacteria | 4798 |
| 52 | JGI24698J34947_10014216 | 3300002449 | Bacteria | 4334 |
| 53 | JGI24698J34947_10018378 | 3300002449 | Bacteria | 3778 |
| 54 | JGI24698J34947_10020811 | 3300002449 | Bacteria | 3532 |
| 55 | JGI24695J34938_10002227 | 3300002450 | Bacteria | 15057 |
| 56 | Ga0072941_1055941 | 3300005201 | Bacteria | 5692 |
| 57 | Ga0072941_1181497 | 3300005201 | Bacteria | 2254 |
| 58 | Ga0466703_307762 | 3300042636 | Bacteria | 6888 |
| 59 | Ga0466712_014792 | 3300042614 | Bacteria | 30692 |
| 60 | Ga0466712_071807 | 3300042614 | Bacteria | 12716 |
| 61 | Ga0466694_005020 | 3300042594 | Bacteria | 10868 |
| 62 | Ga0466694_396163 | 3300042594 | Bacteria | 2298 |
| 63 | Ga0466699_063387 | 3300042597 | Bacteria | 3689 |
| 64 | Ga0466699_099387 | 3300042597 | Bacteria | 3222 |
| 65 | Ga0466699_291383 | 3300042597 | Bacteria | 5169 |
| 66 | JGI24698J34947_10008212 | 3300002449 | Bacteria | 5727 |
| 67 | JGI24698J34947_10012150 | 3300002449 | Bacteria | 4726 |
| 68 | JGI24698J34947_10031480 | 3300002449 | Bacteria | 2792 |
| 69 | Ga0072941_1004521 | 3300005201 | Unclassified | 2127 |
| 70 | Ga0072941_1004541 | 3300005201 | Bacteria | 6669 |
| 71 | Ga0466722_142686 | 3300042609 | Bacteria | 10600 |
| 72 | Ga0466698_493426 | 3300042610 | Bacteria | 1641 |
| 73 | Ga0466702_202331 | 3300042635 | Bacteria | 4144 |
| 74 | Ga0466704_592619 | 3300042643 | Bacteria | 13226 |
| 75 | Ga0466712_003200 | 3300042614 | Bacteria | 27121 |
| 76 | Ga0466712_013857 | 3300042614 | Bacteria | 4200 |
| 77 | Ga0466712_070644 | 3300042614 | Bacteria | 35198 |
| 78 | Ga0466712_130437 | 3300042614 | Bacteria | 4569 |
| 79 | Ga0466712_161116 | 3300042614 | Bacteria | 5608 |
| 80 | Ga0466718_081679 | 3300042617 | Bacteria | 5637 |
| 81 | Ga0466726_389937 | 3300042619 | Bacteria | 3323 |
| 82 | Ga0264413_107518 | 3300024493 | Bacteria | 40797 |
| 83 | Ga0466694_140352 | 3300042594 | Bacteria | 4264 |
| 84 | JGI24698J34947_10003688 | 3300002449 | Bacteria | 8328 |
| 85 | JGI24699J35502_11133970 | 3300002509 | Bacteria | 21986 |
| 86 | Ga0072940_1008742 | 3300005200 | Bacteria | 5838 |
| 87 | Ga0466732_076596 | 3300042656 | Bacteria | 2054 |
| 88 | Ga0123355_10100751 | 3300009826 | Unclassified | 4549 |
| 89 | Ga0123356_10002040 | 3300010049 | Bacteria | 21761 |
| 90 | Ga0123356_10155470 | 3300010049 | Bacteria | 2277 |
| 91 | Ga0466712_135379 | 3300042614 | Bacteria | 4033 |
| 92 | Ga0466718_043663 | 3300042617 | Bacteria | 4504 |
| 93 | Ga0466718_073236 | 3300042617 | Bacteria | 5290 |
| 94 | Ga0466699_048393 | 3300042597 | Bacteria | 18418 |
| 95 | JGI24698J34947_10001214 | 3300002449 | Bacteria | 13485 |
| 96 | JGI24698J34947_10005767 | 3300002449 | Bacteria | 6789 |
| 97 | JGI24695J34938_10010423 | 3300002450 | Bacteria | 5087 |
| 98 | Ga0072941_1056650 | 3300005201 | Bacteria | 5181 |
| 99 | Ga0466722_055894 | 3300042609 | Bacteria | 6336 |
| 100 | Ga0466731_394930 | 3300042622 | Bacteria | 3658 |
| 101 | Ga0466718_006614 | 3300042617 | Bacteria | 30223 |
| 102 | Ga0466694_136825 | 3300042594 | Bacteria | 22203 |
| 103 | JGI24698J34947_10009513 | 3300002449 | Bacteria | 5334 |
| 104 | JGI24698J34947_10012302 | 3300002449 | Bacteria | 4690 |
| 105 | JGI24698J34947_10044673 | 3300002449 | Bacteria | 2266 |
| 106 | JGI24698J34947_10048196 | 3300002449 | Bacteria | 2159 |
| 107 | Ga0072940_1009382 | 3300005200 | Bacteria | 10032 |
| 108 | Ga0072941_1000579 | 3300005201 | Bacteria | 109731 |
| 109 | Ga0072941_1013989 | 3300005201 | Bacteria | 3853 |
| 110 | Ga0072941_1023323 | 3300005201 | Bacteria | 18143 |
| 111 | Ga0466720_021092 | 3300042607 | Bacteria | 3110 |
| 112 | Ga0466720_097922 | 3300042607 | Bacteria | 6810 |
| 113 | Ga0466720_115436 | 3300042607 | Bacteria | 52557 |
| 114 | Ga0466698_320680 | 3300042610 | Bacteria | 12014 |
| 115 | Ga0466732_045006 | 3300042656 | Bacteria | 6909 |
| 116 | Ga0466732_069918 | 3300042656 | Bacteria | 2688 |
| 117 | Ga0466732_119877 | 3300042656 | Bacteria | 14151 |
| 118 | Ga0466712_102351 | 3300042614 | Bacteria | 8926 |
| 119 | Ga0466712_225880 | 3300042614 | Bacteria | 7293 |
| 120 | Ga0466712_263907 | 3300042614 | Bacteria | 2397 |
| 121 | Ga0466715_205101 | 3300042616 | Bacteria | 12493 |
| 122 | Ga0466718_037288 | 3300042617 | Bacteria | 3309 |
| 123 | Ga0466723_145938 | 3300042618 | Bacteria | 1673 |
| 124 | Ga0466699_011506 | 3300042597 | Unclassified | 2293 |
| 125 | Ga0466699_135935 | 3300042597 | Bacteria | 2161 |
| 126 | Ga0466699_140170 | 3300042597 | Bacteria | 7515 |
| 127 | Ga0466699_229331 | 3300042597 | Bacteria | 37974 |
| 128 | JGI24695J34938_10000592 | 3300002450 | Bacteria | 34889 |
| 129 | JGI24702J35022_10003927 | 3300002462 | Bacteria | 8933 |
| 130 | Ga0072941_1006900 | 3300005201 | Bacteria | 6535 |
| 131 | Ga0466720_210159 | 3300042607 | Bacteria | 13825 |
| 132 | Ga0466722_107401 | 3300042609 | Bacteria | 8100 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF08299 | Bac_DnaA_C | Bacterial dnaA protein helix-turn-helix | 362 | 430 | 0.99 |
| PF00308 | Bac_DnaA | Bacterial DnaA ATPAse domain | 134 | 293 | 0.97 |
| PF11638 | DnaA_N | DnaA N-terminal domain | 9 | 68 | 0.92 |
| PF01695 | IstB_IS21 | IstB-like ATP binding protein | 171 | 272 | 0.9 |
| PF00004 | AAA | ATPase family associated with various cellular activities (AAA) | 172 | 292 | 0.8 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01695 | GO:0005524 | ATP binding | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.