Protein Family IF01328

Metagenome Isolate
143 Members
39 Samples
132 Scaffolds
457.83 Avg Length

🧬 Representative Sequence

ID
3300005201|Ga0072941_1056650|Ga0072941_10566503
Length
459 aa
Sequence
MDRVDFKILWDKTLDLLKLELGEDVFGGWFTDIRYLKSEENRIYIGFPSAFYLDRVKTLYQKTISAKLKELQGEEISLEFEVIPGNETKDADTERKKPADTNIVTANGKPDDISTEKKEEKPAVKQNKKKHPQLRDDFTFEKYVIGENNNFAANAAMAISTNPGTTHNPFFIYGGVGLGKTHLMQAIGNYIHENSDNKVICVTSEDFLNEYLLALKDREMPAFKNRFRYTDVLLIDDIQFFQEKEGVQEEFFHTFNQLIGAKKQIVMTCDRPPFELKKISDRLVSRFEQGIRADLQPPRYEVPDEVIDLVGKNISSNVRDLIGALNTLIAYTEIMGKSITLDIAQQKLRDVFASRRQANLSIETIQKVVTDFYNLSSNDLKGRKRNQKIVYPRQIAMYICRELTDYSTTEIGEAFGGRDHSTVMHSTEKIQDLLITDPSLDSTIENLKRQIKELSAKS*

πŸ“Š Sample Types

Isolate 7.7%
Metagenome 92.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Termitidae 51.4%
Unclassified 27.0%
Kalotermitidae 13.5%
Rhinotermitidae 5.4%
Termopsidae 2.7%

🌳 Taxonomy

Archaea 0
Bacteria 137
Eukaryota 0
Viruses 0
Unclassified 6

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
2 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
3 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
4 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
5 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
6 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
7 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
8 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
9 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
10 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
11 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
12 2781125646 Treponema sp. Co191P3bin59 Isolate Unclassified
13 2781125692 Treponema sp. Th196P3bin31 Isolate Unclassified
14 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
15 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
16 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
17 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
18 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
19 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
20 2781125635 Treponema sp. Co191P1bin60 Isolate Unclassified
21 2781125689 Treponema sp. Mp193P4bin9 Isolate Unclassified
22 2820020240 Unclassified Spirochaetes Nc150P3bin10 Isolate Unclassified
23 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
24 2781125631 Treponema sp. Nt197P3bin89 Isolate Unclassified
25 2781125645 Treponema sp. Co191P3bin32 Isolate Unclassified
26 2781125656 Treponema sp. Emb289P1bin65 Isolate Unclassified
27 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
28 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
29 2781125696 Treponema sp. Th196P4bin22 Isolate Unclassified
30 2819992462 Unclassified Spirochaetes Nc150P4bin14 Isolate Unclassified
31 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
32 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
33 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
34 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
35 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
36 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
37 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
38 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
39 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466732_326301 3300042656 Bacteria 7632
2 Ga0466731_111941 3300042622 Bacteria 8493
3 Ga0466712_019351 3300042614 Unclassified 2494
4 Ga0466712_060791 3300042614 Unclassified 3968
5 Ga0466712_083061 3300042614 Bacteria 9961
6 Ga0466712_198445 3300042614 Bacteria 3342
7 Ga0466711_066804 3300042615 Bacteria 6745
8 Ga0264413_109344 3300024493 Bacteria 3516
9 Ga0264413_109565 3300024493 Bacteria 11496
10 Ga0466694_219378 3300042594 Bacteria 5049
11 Ga0466694_237342 3300042594 Bacteria 9829
12 Ga0466699_009862 3300042597 Bacteria 72863
13 Ga0466699_228986 3300042597 Bacteria 3450
14 AustNasuHG_c1000826 3300000089 Bacteria 11129
15 JGI24698J34947_10002576 3300002449 Bacteria 9788
16 JGI24698J34947_10021402 3300002449 Bacteria 3479
17 Ga0123353_10002833 3300010167 Bacteria 21676
18 Ga0466712_063145 3300042614 Bacteria 7233
19 Ga0466712_146325 3300042614 Bacteria 3734
20 Ga0466712_204472 3300042614 Bacteria 4223
21 Ga0466712_291651 3300042614 Bacteria 3962
22 Ga0466692_060721 3300042591 Bacteria 15119
23 Ga0466694_107279 3300042594 Bacteria 1745
24 Ga0466694_196391 3300042594 Bacteria 4503
25 Ga0466694_253043 3300042594 Bacteria 3529
26 Ga0466699_020661 3300042597 Bacteria 15510
27 Ga0466699_284827 3300042597 Bacteria 14833
28 JGI24698J34947_10004438 3300002449 Bacteria 7638
29 JGI24698J34947_10013159 3300002449 Unclassified 4521
30 JGI24698J34947_10018668 3300002449 Bacteria 3745
31 JGI24695J34938_10001820 3300002450 Bacteria 17418
32 JGI24702J35022_10006000 3300002462 Bacteria 7056
33 Ga0072941_1043397 3300005201 Bacteria 2214
34 Ga0072941_1043782 3300005201 Bacteria 4439
35 Ga0466717_027003 3300042604 Bacteria 2425
36 Ga0466722_167867 3300042609 Bacteria 10216
37 Ga0466712_003015 3300042614 Bacteria 4821
38 Ga0466712_074761 3300042614 Bacteria 3223
39 Ga0466712_100129 3300042614 Bacteria 8525
40 Ga0466718_011064 3300042617 Bacteria 26269
41 Ga0466718_057300 3300042617 Bacteria 23198
42 Ga0264413_113668 3300024493 Bacteria 13305
43 Ga0466692_001256 3300042591 Bacteria 23042
44 Ga0466694_257739 3300042594 Bacteria 1668
45 Ga0466694_333017 3300042594 Bacteria 9653
46 Ga0466699_000655 3300042597 Bacteria 10504
47 Ga0466699_029059 3300042597 Bacteria 4296
48 Ga0466699_142108 3300042597 Bacteria 2770
49 Ga0466699_431883 3300042597 Bacteria 26603
50 JGI24698J34947_10010274 3300002449 Bacteria 5131
51 JGI24698J34947_10011807 3300002449 Bacteria 4798
52 JGI24698J34947_10014216 3300002449 Bacteria 4334
53 JGI24698J34947_10018378 3300002449 Bacteria 3778
54 JGI24698J34947_10020811 3300002449 Bacteria 3532
55 JGI24695J34938_10002227 3300002450 Bacteria 15057
56 Ga0072941_1055941 3300005201 Bacteria 5692
57 Ga0072941_1181497 3300005201 Bacteria 2254
58 Ga0466703_307762 3300042636 Bacteria 6888
59 Ga0466712_014792 3300042614 Bacteria 30692
60 Ga0466712_071807 3300042614 Bacteria 12716
61 Ga0466694_005020 3300042594 Bacteria 10868
62 Ga0466694_396163 3300042594 Bacteria 2298
63 Ga0466699_063387 3300042597 Bacteria 3689
64 Ga0466699_099387 3300042597 Bacteria 3222
65 Ga0466699_291383 3300042597 Bacteria 5169
66 JGI24698J34947_10008212 3300002449 Bacteria 5727
67 JGI24698J34947_10012150 3300002449 Bacteria 4726
68 JGI24698J34947_10031480 3300002449 Bacteria 2792
69 Ga0072941_1004521 3300005201 Unclassified 2127
70 Ga0072941_1004541 3300005201 Bacteria 6669
71 Ga0466722_142686 3300042609 Bacteria 10600
72 Ga0466698_493426 3300042610 Bacteria 1641
73 Ga0466702_202331 3300042635 Bacteria 4144
74 Ga0466704_592619 3300042643 Bacteria 13226
75 Ga0466712_003200 3300042614 Bacteria 27121
76 Ga0466712_013857 3300042614 Bacteria 4200
77 Ga0466712_070644 3300042614 Bacteria 35198
78 Ga0466712_130437 3300042614 Bacteria 4569
79 Ga0466712_161116 3300042614 Bacteria 5608
80 Ga0466718_081679 3300042617 Bacteria 5637
81 Ga0466726_389937 3300042619 Bacteria 3323
82 Ga0264413_107518 3300024493 Bacteria 40797
83 Ga0466694_140352 3300042594 Bacteria 4264
84 JGI24698J34947_10003688 3300002449 Bacteria 8328
85 JGI24699J35502_11133970 3300002509 Bacteria 21986
86 Ga0072940_1008742 3300005200 Bacteria 5838
87 Ga0466732_076596 3300042656 Bacteria 2054
88 Ga0123355_10100751 3300009826 Unclassified 4549
89 Ga0123356_10002040 3300010049 Bacteria 21761
90 Ga0123356_10155470 3300010049 Bacteria 2277
91 Ga0466712_135379 3300042614 Bacteria 4033
92 Ga0466718_043663 3300042617 Bacteria 4504
93 Ga0466718_073236 3300042617 Bacteria 5290
94 Ga0466699_048393 3300042597 Bacteria 18418
95 JGI24698J34947_10001214 3300002449 Bacteria 13485
96 JGI24698J34947_10005767 3300002449 Bacteria 6789
97 JGI24695J34938_10010423 3300002450 Bacteria 5087
98 Ga0072941_1056650 3300005201 Bacteria 5181
99 Ga0466722_055894 3300042609 Bacteria 6336
100 Ga0466731_394930 3300042622 Bacteria 3658
101 Ga0466718_006614 3300042617 Bacteria 30223
102 Ga0466694_136825 3300042594 Bacteria 22203
103 JGI24698J34947_10009513 3300002449 Bacteria 5334
104 JGI24698J34947_10012302 3300002449 Bacteria 4690
105 JGI24698J34947_10044673 3300002449 Bacteria 2266
106 JGI24698J34947_10048196 3300002449 Bacteria 2159
107 Ga0072940_1009382 3300005200 Bacteria 10032
108 Ga0072941_1000579 3300005201 Bacteria 109731
109 Ga0072941_1013989 3300005201 Bacteria 3853
110 Ga0072941_1023323 3300005201 Bacteria 18143
111 Ga0466720_021092 3300042607 Bacteria 3110
112 Ga0466720_097922 3300042607 Bacteria 6810
113 Ga0466720_115436 3300042607 Bacteria 52557
114 Ga0466698_320680 3300042610 Bacteria 12014
115 Ga0466732_045006 3300042656 Bacteria 6909
116 Ga0466732_069918 3300042656 Bacteria 2688
117 Ga0466732_119877 3300042656 Bacteria 14151
118 Ga0466712_102351 3300042614 Bacteria 8926
119 Ga0466712_225880 3300042614 Bacteria 7293
120 Ga0466712_263907 3300042614 Bacteria 2397
121 Ga0466715_205101 3300042616 Bacteria 12493
122 Ga0466718_037288 3300042617 Bacteria 3309
123 Ga0466723_145938 3300042618 Bacteria 1673
124 Ga0466699_011506 3300042597 Unclassified 2293
125 Ga0466699_135935 3300042597 Bacteria 2161
126 Ga0466699_140170 3300042597 Bacteria 7515
127 Ga0466699_229331 3300042597 Bacteria 37974
128 JGI24695J34938_10000592 3300002450 Bacteria 34889
129 JGI24702J35022_10003927 3300002462 Bacteria 8933
130 Ga0072941_1006900 3300005201 Bacteria 6535
131 Ga0466720_210159 3300042607 Bacteria 13825
132 Ga0466722_107401 3300042609 Bacteria 8100

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF08299 Bac_DnaA_C Bacterial dnaA protein helix-turn-helix 362 430 0.99
PF00308 Bac_DnaA Bacterial DnaA ATPAse domain 134 293 0.97
PF11638 DnaA_N DnaA N-terminal domain 9 68 0.92
PF01695 IstB_IS21 IstB-like ATP binding protein 171 272 0.9
PF00004 AAA ATPase family associated with various cellular activities (AAA) 172 292 0.8

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF01695 GO:0005524 ATP binding MF

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.