Protein Family IF01315
Metagenome
Isolate
107
Members
36
Samples
103
Scaffolds
113.8
Avg Length
Representative Sequence
- ID
- 3300005201|Ga0072941_1036760|Ga0072941_10367601
- Length
- 123 aa
- Sequence
- MDRDSGIVKHIIQHIENALNAQKRFGDDFKTFVSDKDYFNSVCMSLLQIGELAHHLRTEFTIKHSDIPWKSIIGLRNVVVHGYGQLDAETVWATLTDDMPKLYQQFKNIDDKECVLPETKNT*
Sample Types
Isolate
3.7%
Metagenome
96.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
61.8%
Unclassified
14.7%
Kalotermitidae
8.8%
Termopsidae
8.8%
Rhinotermitidae
5.9%
Taxonomy
Archaea
0
Bacteria
86
Eukaryota
0
Viruses
0
Unclassified
21
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125629 | Treponema sp. Nt197P3bin20 | Isolate | Unclassified |
| 2 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 3 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 4 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 5 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 6 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 7 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 8 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 9 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 10 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 11 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 12 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 13 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 14 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 15 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 16 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 17 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 18 | 2820021908 | Unclassified Spirochaetes Lab288P4bin6 | Isolate | Unclassified |
| 19 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 20 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 21 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 22 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 23 | 2781125691 | Treponema sp. Th196P3bin73 | Isolate | Unclassified |
| 24 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 25 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 26 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 27 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 28 | 2781125651 | Treponema sp. Co191P3bin8 | Isolate | Unclassified |
| 29 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 30 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 31 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 32 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 33 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 34 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 35 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 36 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466720_157729 | 3300042607 | Bacteria | 1358 |
| 2 | Ga0123356_10892169 | 3300010049 | Bacteria | 1060 |
| 3 | Ga0466712_120010 | 3300042614 | Bacteria | 41166 |
| 4 | Ga0466712_131967 | 3300042614 | Bacteria | 1897 |
| 5 | Ga0466712_187162 | 3300042614 | Bacteria | 11305 |
| 6 | Ga0466718_089430 | 3300042617 | Bacteria | 2781 |
| 7 | Ga0466727_328032 | 3300042655 | Bacteria | 1502 |
| 8 | Ga0264413_100851 | 3300024493 | Bacteria | 32165 |
| 9 | Ga0264413_124682 | 3300024493 | Bacteria | 1710 |
| 10 | Ga0466699_335273 | 3300042597 | Bacteria | 1399 |
| 11 | Ga0466699_348730 | 3300042597 | Bacteria | 9744 |
| 12 | Ga0466707_024442 | 3300042601 | Bacteria | 1576 |
| 13 | Ga0123356_12795982 | 3300010049 | Bacteria | 611 |
| 14 | Ga0466726_257886 | 3300042619 | Bacteria | 2237 |
| 15 | Ga0466729_093660 | 3300042621 | Bacteria | 2102 |
| 16 | JGI24698J34947_10019388 | 3300002449 | Bacteria | 3669 |
| 17 | JGI24698J34947_10032012 | 3300002449 | Bacteria | 2764 |
| 18 | JGI24698J34947_10182530 | 3300002449 | Unclassified | 837 |
| 19 | JGI24698J34947_10197466 | 3300002449 | Bacteria | 791 |
| 20 | Ga0072940_1192744 | 3300005200 | Unclassified | 998 |
| 21 | Ga0072941_1095385 | 3300005201 | Bacteria | 4001 |
| 22 | Ga0466727_084605 | 3300042655 | Bacteria | 2018 |
| 23 | Ga0466694_016580 | 3300042594 | Bacteria | 1030 |
| 24 | Ga0466699_056661 | 3300042597 | Bacteria | 1094 |
| 25 | Ga0466720_040675 | 3300042607 | Bacteria | 8229 |
| 26 | Ga0466720_148380 | 3300042607 | Bacteria | 2402 |
| 27 | Ga0466718_067092 | 3300042617 | Bacteria | 4151 |
| 28 | Ga0466718_101944 | 3300042617 | Bacteria | 18573 |
| 29 | Ga0466726_293854 | 3300042619 | Bacteria | 1486 |
| 30 | JGI24698J34947_10130272 | 3300002449 | Bacteria | 1076 |
| 31 | JGI24698J34947_10186088 | 3300002449 | Bacteria | 826 |
| 32 | Ga0072941_1012732 | 3300005201 | Unclassified | 10443 |
| 33 | Ga0072941_1054338 | 3300005201 | Bacteria | 704 |
| 34 | Ga0466692_038966 | 3300042591 | Unclassified | 1753 |
| 35 | Ga0466707_178876 | 3300042601 | Unclassified | 1940 |
| 36 | Ga0466707_295240 | 3300042601 | Bacteria | 1737 |
| 37 | Ga0466721_138213 | 3300042608 | Unclassified | 1426 |
| 38 | Ga0123357_10378893 | 3300009784 | Bacteria | 1316 |
| 39 | AustNasuHG_c1001248 | 3300000089 | Bacteria | 9157 |
| 40 | AustNasuHG_c1009259 | 3300000089 | Bacteria | 3460 |
| 41 | JGI24698J34947_10052020 | 3300002449 | Bacteria | 2057 |
| 42 | Ga0072941_1021399 | 3300005201 | Bacteria | 5028 |
| 43 | Ga0466727_217918 | 3300042655 | Bacteria | 1055 |
| 44 | Ga0466696_042275 | 3300042596 | Bacteria | 3076 |
| 45 | Ga0466732_002349 | 3300042656 | Bacteria | 18621 |
| 46 | Ga0466720_008510 | 3300042607 | Bacteria | 46869 |
| 47 | Ga0123356_11073255 | 3300010049 | Unclassified | 974 |
| 48 | Ga0123353_10240622 | 3300010167 | Unclassified | 2812 |
| 49 | Ga0466718_021707 | 3300042617 | Bacteria | 1622 |
| 50 | Ga0466718_040791 | 3300042617 | Bacteria | 1096 |
| 51 | JGI24698J34947_10000146 | 3300002449 | Bacteria | 26723 |
| 52 | JGI24698J34947_10033533 | 3300002449 | Bacteria | 2693 |
| 53 | JGI24698J34947_10034021 | 3300002449 | Bacteria | 2670 |
| 54 | JGI24698J34947_10203799 | 3300002449 | Bacteria | 772 |
| 55 | Ga0072941_1010743 | 3300005201 | Bacteria | 35389 |
| 56 | Ga0072941_1072220 | 3300005201 | Bacteria | 5834 |
| 57 | Ga0466734_053027 | 3300042623 | Bacteria | 1461 |
| 58 | Ga0466699_252923 | 3300042597 | Bacteria | 1431 |
| 59 | Ga0466714_094741 | 3300042603 | Bacteria | 6771 |
| 60 | Ga0466720_146199 | 3300042607 | Bacteria | 1424 |
| 61 | Ga0123357_10196462 | 3300009784 | Bacteria | 2309 |
| 62 | Ga0123356_11159186 | 3300010049 | Unclassified | 940 |
| 63 | Ga0123353_12826811 | 3300010167 | Bacteria | 568 |
| 64 | JGI24698J34947_10010465 | 3300002449 | Bacteria | 5089 |
| 65 | JGI24698J34947_10050595 | 3300002449 | Bacteria | 2094 |
| 66 | JGI24698J34947_10088920 | 3300002449 | Unclassified | 1424 |
| 67 | JGI24698J34947_10139528 | 3300002449 | Unclassified | 1023 |
| 68 | JGI24698J34947_10140975 | 3300002449 | Bacteria | 1016 |
| 69 | Ga0072940_1018098 | 3300005200 | Bacteria | 2180 |
| 70 | Ga0072941_1040618 | 3300005201 | Bacteria | 5370 |
| 71 | Ga0466729_203794 | 3300042621 | Bacteria | 1988 |
| 72 | Ga0466707_248514 | 3300042601 | Unclassified | 1382 |
| 73 | Ga0466698_369918 | 3300042610 | Bacteria | 1112 |
| 74 | Ga0123353_10512625 | 3300010167 | Unclassified | 1743 |
| 75 | Ga0466712_147039 | 3300042614 | Bacteria | 1960 |
| 76 | Ga0466712_243463 | 3300042614 | Unclassified | 2131 |
| 77 | Ga0466718_007243 | 3300042617 | Bacteria | 5277 |
| 78 | JGI24698J34947_10145425 | 3300002449 | Unclassified | 992 |
| 79 | Ga0072940_1072975 | 3300005200 | Unclassified | 1299 |
| 80 | Ga0072941_1038071 | 3300005201 | Bacteria | 876 |
| 81 | Ga0074263_113308 | 3300005485 | Unclassified | 832 |
| 82 | Ga0466734_113739 | 3300042623 | Bacteria | 1808 |
| 83 | Ga0466702_397285 | 3300042635 | Unclassified | 1535 |
| 84 | Ga0466702_412978 | 3300042635 | Bacteria | 1986 |
| 85 | Ga0466699_156459 | 3300042597 | Bacteria | 3078 |
| 86 | Ga0466732_035703 | 3300042656 | Bacteria | 1232 |
| 87 | Ga0466720_162614 | 3300042607 | Bacteria | 4358 |
| 88 | Ga0123356_11024033 | 3300010049 | Bacteria | 995 |
| 89 | Ga0123353_12104282 | 3300010167 | Bacteria | 687 |
| 90 | Ga0123353_12107266 | 3300010167 | Bacteria | 686 |
| 91 | Ga0466718_006878 | 3300042617 | Bacteria | 2281 |
| 92 | Ga0466723_095883 | 3300042618 | Bacteria | 11936 |
| 93 | JGI24698J34947_10005776 | 3300002449 | Bacteria | 6785 |
| 94 | JGI24702J35022_10605214 | 3300002462 | Bacteria | 678 |
| 95 | JGI24699J35502_11123585 | 3300002509 | Bacteria | 3567 |
| 96 | Ga0068302_10080162 | 3300005071 | Bacteria | 1443 |
| 97 | Ga0072941_1036760 | 3300005201 | Bacteria | 769 |
| 98 | Ga0466727_298263 | 3300042655 | Unclassified | 1436 |
| 99 | Ga0466691_138096 | 3300042593 | Bacteria | 2093 |
| 100 | Ga0466695_147509 | 3300042595 | Bacteria | 5953 |
| 101 | Ga0466699_202015 | 3300042597 | Bacteria | 5459 |
| 102 | Ga0466699_225856 | 3300042597 | Unclassified | 1019 |
| 103 | Ga0466699_403282 | 3300042597 | Unclassified | 1017 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01934 | HepT-like | Ribonuclease HepT-like | 17 | 109 | 0.91 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.