Protein Family IF01303
Metagenome
Metatranscriptome
Isolate
129
Members
36
Samples
118
Scaffolds
213.51
Avg Length
Representative Sequence
- ID
- 3300005201|Ga0072941_1021695|Ga0072941_10216952
- Length
- 250 aa
- Sequence
- VFVNDICAVYYILIYCLRIRKVIKMKKNILILIWLLTAVFCFGQSNFTRGEELFMQNNPAQASIFLENAVADDPAHVLAWLYLGISYEQLNRSDEAIAAYRRILPIAGNLSANIANNLGNVYFHRGNTEMAEQYYTQAIGFDSVYSRAYLGRANTRIKAGNLRNAITDYEQYLTLEPRSSQRARIEQLVSLIRAEFAAEERQRIIALAEERQRILDAVSASLSSAADYSQGISSGAESVEGYDGEFILD*
Sample Types
Isolate
8.5%
Metagenome
90.7%
MAG
0.0%
Metatranscriptome
0.8%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
58.8%
Unclassified
29.4%
Rhinotermitidae
5.9%
Kalotermitidae
2.9%
Termopsidae
2.9%
Taxonomy
Archaea
1
Bacteria
119
Eukaryota
0
Viruses
0
Unclassified
9
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 2 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 3 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 4 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 5 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 6 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 7 | 2781125657 | Treponema sp. Emb289P3bin15 | Isolate | Unclassified |
| 8 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 9 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 10 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 11 | 2781125637 | Treponema sp. Co191P1bin9 | Isolate | Unclassified |
| 12 | 2781125646 | Treponema sp. Co191P3bin59 | Isolate | Unclassified |
| 13 | 2781125692 | Treponema sp. Th196P3bin31 | Isolate | Unclassified |
| 14 | 2781125635 | Treponema sp. Co191P1bin60 | Isolate | Unclassified |
| 15 | 2781125636 | Treponema sp. Co191P1bin67 | Isolate | Unclassified |
| 16 | 2781125662 | Treponema sp. Emb289P3bin141 | Isolate | Unclassified |
| 17 | 2820020240 | Unclassified Spirochaetes Nc150P3bin10 | Isolate | Unclassified |
| 18 | 3300022815 | Termite gut microbial communities from Microcerotermes sp. nest - French Guiana - 27-16 mRNA | Metatranscriptome | Termitidae |
| 19 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 20 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 21 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 22 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 23 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 24 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 25 | 2819992462 | Unclassified Spirochaetes Nc150P4bin14 | Isolate | Unclassified |
| 26 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 27 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 28 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 29 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 30 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 31 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 32 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 33 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 34 | 2781125645 | Treponema sp. Co191P3bin32 | Isolate | Unclassified |
| 35 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 36 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0415639_029594 | 3300038395 | Bacteria | 8995 |
| 2 | Ga0415639_169924 | 3300038395 | Bacteria | 1879 |
| 3 | Ga0466694_029179 | 3300042594 | Bacteria | 24696 |
| 4 | Ga0466694_109930 | 3300042594 | Bacteria | 5229 |
| 5 | Ga0466694_370697 | 3300042594 | Bacteria | 1271 |
| 6 | Ga0466699_035422 | 3300042597 | Bacteria | 6813 |
| 7 | Ga0123356_10000558 | 3300010049 | Bacteria | 41407 |
| 8 | Ga0123353_10577749 | 3300010167 | Bacteria | 1613 |
| 9 | Ga0466712_206980 | 3300042614 | Bacteria | 35802 |
| 10 | Ga0466718_075661 | 3300042617 | Bacteria | 4659 |
| 11 | Ga0466718_087149 | 3300042617 | Bacteria | 122153 |
| 12 | Ga0466726_467341 | 3300042619 | Bacteria | 1834 |
| 13 | JGI24698J34947_10000238 | 3300002449 | Bacteria | 22847 |
| 14 | JGI24698J34947_10003673 | 3300002449 | Bacteria | 8340 |
| 15 | JGI24695J34938_10020445 | 3300002450 | Bacteria | 3257 |
| 16 | JGI24695J34938_10089006 | 3300002450 | Unclassified | 1268 |
| 17 | Ga0072941_1000419 | 3300005201 | Bacteria | 2174 |
| 18 | Ga0072941_1001456 | 3300005201 | Unclassified | 3401 |
| 19 | Ga0072941_1021984 | 3300005201 | Bacteria | 9192 |
| 20 | Ga0466722_014445 | 3300042609 | Bacteria | 5602 |
| 21 | Ga0466702_464560 | 3300042635 | Bacteria | 1058 |
| 22 | Ga0466694_037900 | 3300042594 | Bacteria | 2073 |
| 23 | Ga0466699_374240 | 3300042597 | Bacteria | 1736 |
| 24 | Ga0123353_10235009 | 3300010167 | Bacteria | 2854 |
| 25 | Ga0466712_051413 | 3300042614 | Bacteria | 2150 |
| 26 | Ga0466712_082569 | 3300042614 | Bacteria | 8567 |
| 27 | Ga0466712_103169 | 3300042614 | Bacteria | 15770 |
| 28 | Ga0466715_032624 | 3300042616 | Bacteria | 23067 |
| 29 | Ga0466718_013873 | 3300042617 | Bacteria | 29333 |
| 30 | Ga0466718_117102 | 3300042617 | Bacteria | 1782 |
| 31 | JGI24698J34947_10034591 | 3300002449 | Bacteria | 2642 |
| 32 | JGI24695J34938_10002918 | 3300002450 | Bacteria | 12405 |
| 33 | Ga0072941_1001083 | 3300005201 | Bacteria | 14130 |
| 34 | Ga0072941_1233696 | 3300005201 | Bacteria | 3317 |
| 35 | Ga0255786_1007523 | 3300022815 | Bacteria | 1548 |
| 36 | Ga0264413_101508 | 3300024493 | Bacteria | 8913 |
| 37 | Ga0264413_119682 | 3300024493 | Unclassified | 4869 |
| 38 | Ga0264413_133319 | 3300024493 | Bacteria | 3597 |
| 39 | Ga0466692_162461 | 3300042591 | Bacteria | 1279 |
| 40 | Ga0466693_039474 | 3300042592 | Bacteria | 3586 |
| 41 | Ga0123356_10361142 | 3300010049 | Bacteria | 1579 |
| 42 | Ga0466712_133854 | 3300042614 | Bacteria | 2515 |
| 43 | Ga0466712_175107 | 3300042614 | Bacteria | 17105 |
| 44 | Ga0466712_185348 | 3300042614 | Bacteria | 14433 |
| 45 | JGI24698J34947_10000177 | 3300002449 | Bacteria | 25041 |
| 46 | JGI24698J34947_10085441 | 3300002449 | Bacteria | 1466 |
| 47 | Ga0072941_1000418 | 3300005201 | Bacteria | 5211 |
| 48 | Ga0072941_1003125 | 3300005201 | Bacteria | 20621 |
| 49 | Ga0072941_1003126 | 3300005201 | Bacteria | 7911 |
| 50 | Ga0072941_1009711 | 3300005201 | Bacteria | 3159 |
| 51 | Ga0466720_178452 | 3300042607 | Bacteria | 61615 |
| 52 | Ga0466702_204019 | 3300042635 | Bacteria | 13193 |
| 53 | Ga0466694_148978 | 3300042594 | Bacteria | 1301 |
| 54 | Ga0466699_235221 | 3300042597 | Bacteria | 1613 |
| 55 | Ga0466712_004023 | 3300042614 | Bacteria | 6989 |
| 56 | Ga0466712_207563 | 3300042614 | Bacteria | 94540 |
| 57 | Ga0466718_066113 | 3300042617 | Bacteria | 3719 |
| 58 | JGI24698J34947_10042794 | 3300002449 | Bacteria | 2325 |
| 59 | JGI24698J34947_10124352 | 3300002449 | Unclassified | 1114 |
| 60 | JGI24695J34938_10000221 | 3300002450 | Bacteria | 54408 |
| 61 | JGI24695J34938_10004420 | 3300002450 | Bacteria | 9234 |
| 62 | Ga0072940_1019053 | 3300005200 | Bacteria | 3951 |
| 63 | Ga0072941_1000420 | 3300005201 | Bacteria | 14672 |
| 64 | Ga0072941_1163338 | 3300005201 | Bacteria | 1625 |
| 65 | Ga0466694_031650 | 3300042594 | Bacteria | 4359 |
| 66 | Ga0123356_10769202 | 3300010049 | Bacteria | 1133 |
| 67 | Ga0123353_10553209 | 3300010167 | Bacteria | 1659 |
| 68 | Ga0123353_11154518 | 3300010167 | Unclassified | 1022 |
| 69 | JGI24698J34947_10002021 | 3300002449 | Bacteria | 10820 |
| 70 | JGI24698J34947_10005809 | 3300002449 | Archaea | 6766 |
| 71 | JGI24698J34947_10029356 | 3300002449 | Bacteria | 2905 |
| 72 | JGI24698J34947_10049571 | 3300002449 | Bacteria | 2121 |
| 73 | JGI24698J34947_10056590 | 3300002449 | Unclassified | 1949 |
| 74 | JGI24695J34938_10000135 | 3300002450 | Bacteria | 66811 |
| 75 | Ga0072941_1021695 | 3300005201 | Bacteria | 3320 |
| 76 | Ga0466702_373546 | 3300042635 | Bacteria | 1553 |
| 77 | Ga0264413_103996 | 3300024493 | Bacteria | 10665 |
| 78 | Ga0466694_219524 | 3300042594 | Bacteria | 5291 |
| 79 | Ga0123356_10000511 | 3300010049 | Bacteria | 43274 |
| 80 | Ga0123356_10086161 | 3300010049 | Bacteria | 2981 |
| 81 | Ga0466712_220839 | 3300042614 | Bacteria | 21516 |
| 82 | Ga0466712_261852 | 3300042614 | Bacteria | 2099 |
| 83 | Ga0466712_312645 | 3300042614 | Unclassified | 1907 |
| 84 | Ga0466718_035931 | 3300042617 | Bacteria | 5912 |
| 85 | Ga0466718_056599 | 3300042617 | Bacteria | 5515 |
| 86 | JGI24698J34947_10005629 | 3300002449 | Bacteria | 6870 |
| 87 | JGI24698J34947_10053917 | 3300002449 | Unclassified | 2010 |
| 88 | JGI24695J34938_10008103 | 3300002450 | Bacteria | 6045 |
| 89 | JGI24702J35022_10020223 | 3300002462 | Bacteria | 3615 |
| 90 | Ga0072941_1000451 | 3300005201 | Bacteria | 4063 |
| 91 | Ga0072941_1008213 | 3300005201 | Bacteria | 9461 |
| 92 | Ga0466731_305625 | 3300042622 | Bacteria | 1794 |
| 93 | Ga0466694_372156 | 3300042594 | Bacteria | 13291 |
| 94 | Ga0466699_234358 | 3300042597 | Bacteria | 21895 |
| 95 | Ga0466699_381402 | 3300042597 | Bacteria | 8660 |
| 96 | Ga0466699_405178 | 3300042597 | Bacteria | 1564 |
| 97 | JGI24698J34947_10017271 | 3300002449 | Bacteria | 3913 |
| 98 | JGI24698J34947_10030792 | 3300002449 | Bacteria | 2828 |
| 99 | JGI24698J34947_10098365 | 3300002449 | Bacteria | 1322 |
| 100 | JGI24695J34938_10000027 | 3300002450 | Bacteria | 107415 |
| 101 | JGI24695J34938_10000223 | 3300002450 | Bacteria | 53945 |
| 102 | JGI24695J34938_10001544 | 3300002450 | Bacteria | 19407 |
| 103 | Ga0072941_1001041 | 3300005201 | Bacteria | 20837 |
| 104 | Ga0072941_1003124 | 3300005201 | Bacteria | 3918 |
| 105 | Ga0466700_021934 | 3300042600 | Bacteria | 9671 |
| 106 | Ga0466720_033623 | 3300042607 | Bacteria | 30329 |
| 107 | Ga0466720_065498 | 3300042607 | Bacteria | 9005 |
| 108 | Ga0466722_230983 | 3300042609 | Bacteria | 1476 |
| 109 | Ga0466698_097708 | 3300042610 | Bacteria | 1441 |
| 110 | Ga0466698_387122 | 3300042610 | Bacteria | 14948 |
| 111 | Ga0466699_155764 | 3300042597 | Bacteria | 1054 |
| 112 | Ga0123356_10012098 | 3300010049 | Bacteria | 8390 |
| 113 | Ga0466718_024595 | 3300042617 | Bacteria | 5781 |
| 114 | AustNasuHG_c1026889 | 3300000089 | Bacteria | 1778 |
| 115 | JGI24695J34938_10039903 | 3300002450 | Unclassified | 2117 |
| 116 | Ga0466717_092889 | 3300042604 | Bacteria | 1249 |
| 117 | Ga0466722_015708 | 3300042609 | Bacteria | 3454 |
| 118 | Ga0466722_098698 | 3300042609 | Bacteria | 4095 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF00515 | GO:0005515 | protein binding | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.