Protein Family IF01269

Metagenome Isolate
112 Members
35 Samples
110 Scaffolds
232.6 Avg Length

🧬 Representative Sequence

ID
3300005201|Ga0072941_1003408|Ga0072941_100340834
Length
275 aa
Sequence
MLTETKFCEPPMDTLSAGLQQLCAADEETEALIKPRFSEITAALFTYIEEIERFNAAYGLVKVANRDELVVKHILDSLAPIAHIYKPLSGTARDSSVADAGSGAGLPGIPLAICLPGTRFTLIERMGRRAGFLRNVLAVLGLSNCTVEETEIEKAALDEPGEHSEHRESGEPCELKEPGATGRFDTICFRAFHPLTPELLKRLFRLLAPGGRLAAYKGRKNRTEEEMAAAGLESGSWELIPLSVPFLNEERHLAIVPLPPGPIPGQPACDTVDV*

📊 Sample Types

Isolate 1.8%
Metagenome 98.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 50.0%
Kalotermitidae 25.0%
Unclassified 12.5%
Termopsidae 9.4%
Rhinotermitidae 3.1%

🌳 Taxonomy

Archaea 0
Bacteria 105
Eukaryota 0
Viruses 0
Unclassified 7

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125629 Treponema sp. Nt197P3bin20 Isolate Unclassified
2 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
3 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
4 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
5 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
6 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
7 2781125630 Treponema sp. Nt197P3bin60 Isolate Unclassified
8 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
9 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
10 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
11 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
12 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
13 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
14 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
15 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
16 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
17 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
18 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
19 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
20 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
21 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
22 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
23 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
24 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
25 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
26 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
27 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
28 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
29 3300001880 Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome Metagenome
30 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
31 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
32 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
33 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
34 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
35 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_023507 3300042659 Bacteria 3646
2 Ga0466733_105400 3300042659 Bacteria 13353
3 Ga0466719_058039 3300042606 Bacteria 4237
4 Ga0466719_076794 3300042606 Bacteria 9945
5 Ga0466719_078620 3300042606 Bacteria 14549
6 Ga0466722_173435 3300042609 Bacteria 10214
7 Ga0466718_080490 3300042617 Bacteria 18006
8 Ga0466726_438640 3300042619 Bacteria 4687
9 Ga0466703_262677 3300042636 Bacteria 6907
10 Ga0466727_272339 3300042655 Bacteria 1682
11 AustNasuHG_c1009738 3300000089 Bacteria 3366
12 AustNasuHG_c1018463 3300000089 Bacteria 2301
13 JGI24695J34938_10000096 3300002450 Bacteria 77675
14 JGI24695J34938_10058407 3300002450 Bacteria 1655
15 Ga0415639_043198 3300038395 Bacteria 12841
16 Ga0466694_394207 3300042594 Unclassified 3748
17 Ga0466699_106272 3300042597 Bacteria 9653
18 Ga0466720_019974 3300042607 Bacteria 26156
19 Ga0466720_170769 3300042607 Bacteria 7741
20 Ga0466722_262912 3300042609 Bacteria 9980
21 Ga0466726_085751 3300042619 Bacteria 5858
22 Ga0466727_036597 3300042655 Bacteria 3482
23 AustNasuHG_c1009242 3300000089 Bacteria 3463
24 JGI24695J34938_10001893 3300002450 Bacteria 16950
25 JGI24695J34938_10073970 3300002450 Bacteria 1419
26 Ga0123356_10064118 3300010049 Bacteria 3434
27 Ga0466693_315137 3300042592 Bacteria 6096
28 Ga0466691_092532 3300042593 Bacteria 5040
29 Ga0466694_407364 3300042594 Bacteria 1548
30 Ga0466696_148764 3300042596 Bacteria 11044
31 Ga0466699_117157 3300042597 Bacteria 1261
32 Ga0466713_156505 3300042602 Bacteria 12676
33 Ga0466718_133400 3300042617 Bacteria 4281
34 JGI24698J34947_10027101 3300002449 Unclassified 3041
35 Ga0072941_1015250 3300005201 Bacteria 9402
36 Ga0072941_1015338 3300005201 Bacteria 10301
37 Ga0072941_1032181 3300005201 Bacteria 4754
38 Ga0123356_10037877 3300010049 Bacteria 4496
39 Ga0264413_138802 3300024493 Bacteria 4004
40 Ga0415639_144392 3300038395 Bacteria 1188
41 Ga0466707_106745 3300042601 Bacteria 3541
42 Ga0466712_166233 3300042614 Unclassified 2749
43 Ga0466718_071687 3300042617 Bacteria 6095
44 Ga0466708_369381 3300042652 Bacteria 22655
45 AustNasuHG_c1000079 3300000089 Bacteria 27646
46 Ga0072941_1002405 3300005201 Bacteria 6448
47 Ga0072941_1056223 3300005201 Bacteria 1366
48 Ga0123356_10032913 3300010049 Bacteria 4848
49 Ga0123356_10089092 3300010049 Bacteria 2935
50 Ga0466694_275025 3300042594 Bacteria 1526
51 Ga0466696_222666 3300042596 Bacteria 8857
52 Ga0466733_083780 3300042659 Bacteria 18215
53 Ga0466733_125187 3300042659 Bacteria 2369
54 Ga0466733_182615 3300042659 Bacteria 1245
55 Ga0466722_027301 3300042609 Bacteria 4930
56 Ga0466715_130832 3300042616 Bacteria 13260
57 Ga0466718_058072 3300042617 Bacteria 9227
58 Ga0466731_087926 3300042622 Bacteria 2183
59 Ga0466735_117100 3300042624 Bacteria 20761
60 Ga0466703_169533 3300042636 Bacteria 14592
61 JGI24695J34938_10001510 3300002450 Bacteria 19620
62 Ga0072940_1006985 3300005200 Bacteria 2744
63 Ga0072940_1077296 3300005200 Bacteria 3420
64 Ga0072941_1003408 3300005201 Bacteria 36537
65 Ga0123356_10381973 3300010049 Bacteria 1541
66 Ga0466694_056550 3300042594 Bacteria 8920
67 Ga0466718_003473 3300042617 Bacteria 1204
68 Ga0466718_028405 3300042617 Bacteria 6271
69 Ga0466726_124582 3300042619 Bacteria 2988
70 Ga0466727_329162 3300042655 Bacteria 5979
71 AustNasuHG_c1005464 3300000089 Bacteria 4543
72 JGI24695J34938_10011700 3300002450 Bacteria 4709
73 JGI24695J34938_10093014 3300002450 Unclassified 1236
74 Ga0072941_1003799 3300005201 Bacteria 17029
75 Ga0072941_1023862 3300005201 Unclassified 3076
76 Ga0072941_1025575 3300005201 Bacteria 46927
77 Ga0123355_10131786 3300009826 Bacteria 3850
78 Ga0466693_363993 3300042592 Bacteria 4162
79 Ga0466694_288050 3300042594 Bacteria 21720
80 Ga0466733_046948 3300042659 Bacteria 19911
81 Ga0466719_415384 3300042606 Bacteria 85790
82 Ga0466722_245950 3300042609 Bacteria 2400
83 Ga0466712_084399 3300042614 Bacteria 8367
84 Ga0466711_384782 3300042615 Bacteria 24719
85 Ga0466718_092360 3300042617 Bacteria 7531
86 Ga0466727_005305 3300042655 Bacteria 1084
87 JGI24695J34938_10024289 3300002450 Bacteria 2911
88 Ga0072941_1010471 3300005201 Unclassified 5403
89 Ga0072941_1023903 3300005201 Bacteria 4765
90 Ga0072941_1065902 3300005201 Bacteria 958
91 Ga0072941_1088717 3300005201 Bacteria 3836
92 Ga0123356_10358077 3300010049 Bacteria 1585
93 Ga0415639_011549 3300038395 Bacteria 7985
94 Ga0466694_009362 3300042594 Bacteria 28493
95 Ga0466733_029036 3300042659 Bacteria 1799
96 Ga0466718_070183 3300042617 Bacteria 4997
97 Ga0466726_183048 3300042619 Bacteria 1147
98 Ga0466705_037648 3300042612 Bacteria 22325
99 Ga0466731_051364 3300042622 Bacteria 3341
100 Ga0466702_241443 3300042635 Bacteria 3292
101 Ga0466708_145765 3300042652 Bacteria 9206
102 Ga0466727_173262 3300042655 Bacteria 4675
103 FAAS_10004657 3300001880 Unclassified 948
104 JGI24695J34938_10000085 3300002450 Bacteria 80617
105 JGI24695J34938_10000350 3300002450 Bacteria 45521
106 Ga0072941_1010523 3300005201 Bacteria 9873
107 Ga0072941_1011989 3300005201 Bacteria 16070
108 Ga0264413_105653 3300024493 Bacteria 17563
109 Ga0264413_145154 3300024493 Bacteria 1407
110 Ga0466693_113109 3300042592 Bacteria 39343

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042659 Ga0466733_029036 Ga0466733_029036_736_1359 207
2 3300000089 AustNasuHG_c1018463 AustNasuHG_10184632 214
3 3300000089 AustNasuHG_c1005464 AustNasuHG_10054646 215
4 3300005200 Ga0072940_1006985 Ga0072940_10069852 220
5 3300010049 Ga0123356_10064118 Ga0123356_100641184 220
6 3300005200 Ga0072940_1077296 Ga0072940_10772962 221
7 3300042596 Ga0466696_222666 Ga0466696_222666_1424_2089 221
8 3300042597 Ga0466699_117157 Ga0466699_117157_395_1165 222
9 3300042606 Ga0466719_415384 Ga0466719_415384_50752_51420 222
10 3300042609 Ga0466722_173435 Ga0466722_173435_2588_3256 222
11 3300042609 Ga0466722_027301 Ga0466722_027301_633_1304 223
12 3300042609 Ga0466722_245950 Ga0466722_245950_633_1304 223
13 3300042659 Ga0466733_083780 Ga0466733_083780_331_1002 223
14 3300042659 Ga0466733_125187 Ga0466733_125187_988_1659 223
15 3300002450 JGI24695J34938_10024289 JGI24695J34938_100242892 224
16 3300010049 Ga0123356_10089092 Ga0123356_100890923 224
17 3300042594 Ga0466694_394207 Ga0466694_394207_1436_2155 224
18 3300042606 Ga0466719_076794 Ga0466719_076794_1565_2257 224
19 3300042635 Ga0466702_241443 Ga0466702_241443_621_1295 224
20 3300042655 Ga0466727_272339 Ga0466727_272339_906_1580 224
21 3300005201 Ga0072941_1056223 Ga0072941_10562232 225
22 3300042606 Ga0466719_078620 Ga0466719_078620_5835_6530 225
23 3300042617 Ga0466718_003473 Ga0466718_003473_115_822 225
24 3300042619 Ga0466726_183048 Ga0466726_183048_228_905 225
25 3300042655 Ga0466727_036597 Ga0466727_036597_351_1058 225
26 3300005201 Ga0072941_1003799 Ga0072941_100379917 226
27 3300010049 Ga0123356_10032913 Ga0123356_100329134 226
28 3300010049 Ga0123356_10381973 Ga0123356_103819732 226
29 3300042617 Ga0466718_028405 Ga0466718_028405_2446_3126 226
30 3300042617 Ga0466718_071687 Ga0466718_071687_691_1371 226
31 3300024493 Ga0264413_105653 Ga0264413_1056535 228
32 3300042592 Ga0466693_363993 Ga0466693_363993_1663_2349 228
33 3300042601 Ga0466707_106745 Ga0466707_106745_362_1048 228
34 3300042607 Ga0466720_019974 Ga0466720_019974_16060_16746 228
35 3300042617 Ga0466718_080490 Ga0466718_080490_1815_2501 228
36 3300042617 Ga0466718_092360 Ga0466718_092360_3913_4599 228
37 3300042652 Ga0466708_369381 Ga0466708_369381_21199_21885 228
38 3300042655 Ga0466727_173262 Ga0466727_173262_3068_3754 228
39 3300042655 Ga0466727_329162 Ga0466727_329162_804_1490 228
40 3300042659 Ga0466733_046948 Ga0466733_046948_1752_2438 228
41 3300042659 Ga0466733_105400 Ga0466733_105400_7148_7834 228
42 3300000089 AustNasuHG_c1009738 AustNasuHG_10097383 229
43 3300002450 JGI24695J34938_10000085 JGI24695J34938_1000008517 229
44 3300042614 Ga0466712_084399 Ga0466712_084399_1195_1884 229
45 3300042622 Ga0466731_051364 Ga0466731_051364_471_1160 229
46 3300042622 Ga0466731_087926 Ga0466731_087926_411_1100 229
47 3300042659 Ga0466733_023507 Ga0466733_023507_650_1339 229
48 iso_pr_bacteria 2781125629 2781263739 229
49 iso_pr_bacteria 2781125630 2781266172 229
50 3300000089 AustNasuHG_c1009242 AustNasuHG_10092424 230
51 3300002450 JGI24695J34938_10000350 JGI24695J34938_1000035032 230
52 3300005201 Ga0072941_1025575 Ga0072941_102557512 230
53 3300005201 Ga0072941_1088717 Ga0072941_10887174 230
54 3300024493 Ga0264413_138802 Ga0264413_1388023 230
55 3300042594 Ga0466694_275025 Ga0466694_275025_620_1312 230
56 3300042607 Ga0466720_170769 Ga0466720_170769_3269_3961 230
57 3300042617 Ga0466718_058072 Ga0466718_058072_3062_3754 230
58 3300042659 Ga0466733_182615 Ga0466733_182615_482_1174 230
59 3300001880 FAAS_10004657 FAAS_100046572 231
60 3300005201 Ga0072941_1010471 Ga0072941_10104716 231
61 3300005201 Ga0072941_1010523 Ga0072941_101052310 231
62 3300042594 Ga0466694_009362 Ga0466694_009362_11594_12289 231
63 3300042594 Ga0466694_056550 Ga0466694_056550_2710_3405 231
64 3300042594 Ga0466694_288050 Ga0466694_288050_5426_6121 231
65 3300042606 Ga0466719_058039 Ga0466719_058039_2108_2803 231
66 3300042614 Ga0466712_166233 Ga0466712_166233_1481_2176 231
67 3300002449 JGI24698J34947_10027101 JGI24698J34947_100271012 232
68 3300005201 Ga0072941_1023903 Ga0072941_10239032 232
69 3300042612 Ga0466705_037648 Ga0466705_037648_21458_22156 232
70 3300038395 Ga0415639_011549 Ga0415639_011549_2990_3691 233
71 3300042619 Ga0466726_085751 Ga0466726_085751_2309_3010 233
72 3300042636 Ga0466703_262677 Ga0466703_262677_776_1477 233
73 3300042655 Ga0466727_005305 Ga0466727_005305_234_935 233
74 3300005201 Ga0072941_1015250 Ga0072941_10152509 234
75 3300005201 Ga0072941_1023862 Ga0072941_10238623 234
76 3300042596 Ga0466696_148764 Ga0466696_148764_410_1114 234
77 3300042617 Ga0466718_133400 Ga0466718_133400_671_1375 234
78 3300010049 Ga0123356_10358077 Ga0123356_103580772 235
79 3300042619 Ga0466726_438640 Ga0466726_438640_2554_3261 235
80 3300042624 Ga0466735_117100 Ga0466735_117100_13848_14555 235
81 3300002450 JGI24695J34938_10011700 JGI24695J34938_100117005 236
82 3300002450 JGI24695J34938_10073970 JGI24695J34938_100739702 236
83 3300042594 Ga0466694_407364 Ga0466694_407364_127_837 236
84 3300042597 Ga0466699_106272 Ga0466699_106272_3354_4064 236
85 3300002450 JGI24695J34938_10000096 JGI24695J34938_1000009638 237
86 3300005201 Ga0072941_1032181 Ga0072941_10321813 237
87 3300038395 Ga0415639_043198 Ga0415639_043198_4647_5360 237
88 3300042602 Ga0466713_156505 Ga0466713_156505_2825_3541 238
89 3300042593 Ga0466691_092532 Ga0466691_092532_977_1696 239
90 3300042617 Ga0466718_070183 Ga0466718_070183_3803_4522 239
91 3300005201 Ga0072941_1015338 Ga0072941_10153386 241
92 3300042592 Ga0466693_315137 Ga0466693_315137_1694_2419 241
93 3300000089 AustNasuHG_c1000079 AustNasuHG_100007915 242
94 3300009826 Ga0123355_10131786 Ga0123355_101317865 242
95 3300010049 Ga0123356_10037877 Ga0123356_100378772 242
96 3300042636 Ga0466703_169533 Ga0466703_169533_13102_13830 242
97 3300002450 JGI24695J34938_10001893 JGI24695J34938_1000189316 243
98 3300005201 Ga0072941_1065902 Ga0072941_10659021 243
99 3300042615 Ga0466711_384782 Ga0466711_384782_5551_6285 244
100 3300042592 Ga0466693_113109 Ga0466693_113109_20831_21595 245
101 3300042652 Ga0466708_145765 Ga0466708_145765_263_1000 245
102 3300002450 JGI24695J34938_10058407 JGI24695J34938_100584071 246
103 3300002450 JGI24695J34938_10093014 JGI24695J34938_100930142 249
104 3300042616 Ga0466715_130832 Ga0466715_130832_150_899 249
105 3300002450 JGI24695J34938_10001510 JGI24695J34938_100015109 250
106 3300038395 Ga0415639_144392 Ga0415639_144392_300_1055 251
107 3300042619 Ga0466726_124582 Ga0466726_124582_1156_1914 252
108 3300024493 Ga0264413_145154 Ga0264413_1451542 254
109 3300042609 Ga0466722_262912 Ga0466722_262912_8935_9771 258
110 3300005201 Ga0072941_1002405 Ga0072941_10024054 259
111 3300005201 Ga0072941_1011989 Ga0072941_101198918 265
112 3300005201 Ga0072941_1003408 Ga0072941_100340834 275

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02527 GidB rRNA small subunit methyltransferase G 43 253 0.87

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.83 0.91 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.