Protein Family IF01236
Metagenome
Isolate
165
Members
27
Samples
163
Scaffolds
137.51
Avg Length
Representative Sequence
- ID
- 3300005200|Ga0072940_1034321|Ga0072940_10343216
- Length
- 155 aa
- Sequence
- TVLLHGRRHRRRSGKGKIMPALFNFEVHTPRRIFYSAKVQAITIGLEDGEIGIYANHSPFTAHSVTGTLRIKDEGGNWRAAFVCGGILEVKEHKNVLMVESADWPEEIDVEKVLEIKKQAEETLKNAQLQFEIDKAQKKLHHAECRLKVVEQKK*
Sample Types
Isolate
1.2%
Metagenome
98.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
70.8%
Kalotermitidae
16.7%
Unclassified
8.3%
Termopsidae
4.2%
Taxonomy
Archaea
0
Bacteria
150
Eukaryota
0
Viruses
0
Unclassified
15
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2030936001 | Nasutitermes corniger hindgut microbial communities from Florida, USA | Metagenome | Termitidae |
| 2 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 3 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 4 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 5 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 6 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 7 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 8 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 9 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 10 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 11 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 12 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 13 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 14 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 15 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 16 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 17 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 18 | 2820020240 | Unclassified Spirochaetes Nc150P3bin10 | Isolate | Unclassified |
| 19 | 3300001880 | Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome | Metagenome | |
| 20 | 2781125646 | Treponema sp. Co191P3bin59 | Isolate | Unclassified |
| 21 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 22 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 23 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 24 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 25 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 26 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 27 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466712_082488 | 3300042614 | Bacteria | 10958 |
| 2 | Ga0466712_231197 | 3300042614 | Bacteria | 4025 |
| 3 | Ga0466712_298546 | 3300042614 | Bacteria | 2122 |
| 4 | Ga0466718_006182 | 3300042617 | Bacteria | 17388 |
| 5 | Ga0466718_027273 | 3300042617 | Bacteria | 8756 |
| 6 | Ga0466718_060681 | 3300042617 | Bacteria | 8994 |
| 7 | Ga0466718_082483 | 3300042617 | Bacteria | 1534 |
| 8 | AustNasuHG_c1046787 | 3300000089 | Bacteria | 972 |
| 9 | JGI24698J34947_10008957 | 3300002449 | Bacteria | 5488 |
| 10 | JGI24698J34947_10011128 | 3300002449 | Bacteria | 4938 |
| 11 | JGI24698J34947_10022473 | 3300002449 | Bacteria | 3382 |
| 12 | JGI24698J34947_10034169 | 3300002449 | Bacteria | 2663 |
| 13 | JGI24698J34947_10066543 | 3300002449 | Bacteria | 1753 |
| 14 | JGI24698J34947_10092613 | 3300002449 | Bacteria | 1381 |
| 15 | Ga0074263_101502 | 3300005485 | Bacteria | 1474 |
| 16 | Ga0074263_112469 | 3300005485 | Unclassified | 2097 |
| 17 | Ga0466704_121401 | 3300042643 | Bacteria | 16287 |
| 18 | Ga0466720_153845 | 3300042607 | Bacteria | 1780 |
| 19 | Ga0123357_10372881 | 3300009784 | Bacteria | 1335 |
| 20 | Ga0123356_10085587 | 3300010049 | Bacteria | 2991 |
| 21 | Ga0466712_104785 | 3300042614 | Bacteria | 5580 |
| 22 | Ga0466718_026116 | 3300042617 | Bacteria | 2838 |
| 23 | Ga0466726_335802 | 3300042619 | Bacteria | 1165 |
| 24 | AustNasuHG_c1000569 | 3300000089 | Bacteria | 13018 |
| 25 | AustNasuHG_c1001367 | 3300000089 | Bacteria | 8740 |
| 26 | JGI24698J34947_10010845 | 3300002449 | Bacteria | 5000 |
| 27 | JGI24698J34947_10064648 | 3300002449 | Unclassified | 1787 |
| 28 | JGI24698J34947_10103810 | 3300002449 | Bacteria | 1271 |
| 29 | JGI24698J34947_10256140 | 3300002449 | Bacteria | 651 |
| 30 | JGI24698J34947_10283428 | 3300002449 | Bacteria | 604 |
| 31 | Ga0072940_1014726 | 3300005200 | Bacteria | 3536 |
| 32 | Ga0072940_1034321 | 3300005200 | Bacteria | 4376 |
| 33 | Ga0072941_1028285 | 3300005201 | Bacteria | 7016 |
| 34 | Ga0074263_113018 | 3300005485 | Bacteria | 6697 |
| 35 | Ga0074263_113948 | 3300005485 | Bacteria | 3169 |
| 36 | Ga0466720_032242 | 3300042607 | Bacteria | 9368 |
| 37 | Ga0466720_070982 | 3300042607 | Bacteria | 10077 |
| 38 | Ga0466720_143573 | 3300042607 | Bacteria | 6501 |
| 39 | Ga0466720_189955 | 3300042607 | Bacteria | 2986 |
| 40 | Ga0466732_007358 | 3300042656 | Bacteria | 14440 |
| 41 | Ga0466732_092386 | 3300042656 | Bacteria | 77086 |
| 42 | Ga0466732_187981 | 3300042656 | Bacteria | 1744 |
| 43 | Ga0123353_10089779 | 3300010167 | Bacteria | 4948 |
| 44 | Ga0466712_023799 | 3300042614 | Bacteria | 49566 |
| 45 | Nasutiter_Contig09868 | 2030936001 | Unclassified | 2139 |
| 46 | AustNasuHG_c1001044 | 3300000089 | Bacteria | 9962 |
| 47 | AustNasuHG_c1002682 | 3300000089 | Bacteria | 6419 |
| 48 | AustNasuHG_c1011509 | 3300000089 | Bacteria | 3065 |
| 49 | JGI24698J34947_10058026 | 3300002449 | Bacteria | 1918 |
| 50 | JGI24698J34947_10065255 | 3300002449 | Bacteria | 1775 |
| 51 | JGI24698J34947_10099853 | 3300002449 | Bacteria | 1308 |
| 52 | JGI24699J35502_10854992 | 3300002509 | Bacteria | 962 |
| 53 | Ga0072941_1030278 | 3300005201 | Bacteria | 1389 |
| 54 | Ga0466720_018619 | 3300042607 | Bacteria | 3653 |
| 55 | Ga0466720_117270 | 3300042607 | Bacteria | 26315 |
| 56 | Ga0466720_133618 | 3300042607 | Bacteria | 26839 |
| 57 | Ga0466705_191587 | 3300042612 | Bacteria | 7655 |
| 58 | Ga0466732_110655 | 3300042656 | Bacteria | 1727 |
| 59 | Ga0123356_10181256 | 3300010049 | Bacteria | 2128 |
| 60 | Ga0466712_256629 | 3300042614 | Bacteria | 6384 |
| 61 | Ga0466712_278342 | 3300042614 | Bacteria | 2617 |
| 62 | Ga0466718_079759 | 3300042617 | Bacteria | 3625 |
| 63 | Ga0466718_094932 | 3300042617 | Unclassified | 3951 |
| 64 | Ga0466718_126099 | 3300042617 | Bacteria | 1424 |
| 65 | Ga0466718_150719 | 3300042617 | Bacteria | 2253 |
| 66 | AustNasuHG_c1080602 | 3300000089 | Unclassified | 552 |
| 67 | JGI24698J34947_10002496 | 3300002449 | Bacteria | 9930 |
| 68 | JGI24698J34947_10096229 | 3300002449 | Unclassified | 1343 |
| 69 | JGI24695J34938_10001187 | 3300002450 | Bacteria | 23128 |
| 70 | Ga0072941_1064106 | 3300005201 | Bacteria | 4309 |
| 71 | Ga0074263_104167 | 3300005485 | Bacteria | 5477 |
| 72 | Ga0466719_069460 | 3300042606 | Bacteria | 3255 |
| 73 | Ga0466720_021915 | 3300042607 | Bacteria | 13458 |
| 74 | Ga0466720_027731 | 3300042607 | Bacteria | 12345 |
| 75 | Ga0466720_062328 | 3300042607 | Bacteria | 37859 |
| 76 | Ga0466720_106885 | 3300042607 | Bacteria | 6794 |
| 77 | Ga0466732_064544 | 3300042656 | Bacteria | 1921 |
| 78 | Ga0466699_061325 | 3300042597 | Bacteria | 3670 |
| 79 | Ga0466699_357860 | 3300042597 | Unclassified | 1939 |
| 80 | Ga0466712_015336 | 3300042614 | Bacteria | 28683 |
| 81 | Ga0466712_026849 | 3300042614 | Bacteria | 1045 |
| 82 | Ga0466712_251582 | 3300042614 | Bacteria | 1184 |
| 83 | Ga0466718_039843 | 3300042617 | Unclassified | 4980 |
| 84 | Ga0466718_121250 | 3300042617 | Bacteria | 13536 |
| 85 | JGI24698J34947_10007368 | 3300002449 | Bacteria | 6049 |
| 86 | JGI24699J35502_11038716 | 3300002509 | Unclassified | 1560 |
| 87 | Ga0072940_1008469 | 3300005200 | Bacteria | 4915 |
| 88 | Ga0072941_1008336 | 3300005201 | Bacteria | 6736 |
| 89 | Ga0466720_038886 | 3300042607 | Bacteria | 7086 |
| 90 | Ga0466720_108788 | 3300042607 | Bacteria | 6821 |
| 91 | Ga0466720_238804 | 3300042607 | Bacteria | 10855 |
| 92 | Ga0466705_304161 | 3300042612 | Bacteria | 5135 |
| 93 | Ga0466699_078339 | 3300042597 | Bacteria | 1105 |
| 94 | Ga0466712_007854 | 3300042614 | Bacteria | 11262 |
| 95 | Ga0466712_024589 | 3300042614 | Bacteria | 6206 |
| 96 | Ga0466712_284879 | 3300042614 | Bacteria | 1064 |
| 97 | Ga0466718_165191 | 3300042617 | Bacteria | 7851 |
| 98 | AustNasuHG_c1019079 | 3300000089 | Unclassified | 2255 |
| 99 | AustNasuHG_c1054751 | 3300000089 | Bacteria | 817 |
| 100 | FAAS_10176602 | 3300001880 | Bacteria | 555 |
| 101 | JGI24698J34947_10002354 | 3300002449 | Bacteria | 10172 |
| 102 | JGI24698J34947_10045861 | 3300002449 | Unclassified | 2228 |
| 103 | JGI24698J34947_10048245 | 3300002449 | Bacteria | 2158 |
| 104 | JGI24698J34947_10075402 | 3300002449 | Bacteria | 1604 |
| 105 | JGI24698J34947_10109941 | 3300002449 | Bacteria | 1219 |
| 106 | JGI24698J34947_10291023 | 3300002449 | Unclassified | 593 |
| 107 | JGI24695J34938_10447415 | 3300002450 | Bacteria | 583 |
| 108 | JGI24699J35502_10911392 | 3300002509 | Bacteria | 1072 |
| 109 | Ga0072941_1005432 | 3300005201 | Bacteria | 11782 |
| 110 | Ga0072941_1013106 | 3300005201 | Bacteria | 11456 |
| 111 | Ga0072941_1084624 | 3300005201 | Bacteria | 3991 |
| 112 | Ga0074263_104435 | 3300005485 | Bacteria | 2300 |
| 113 | Ga0466704_205209 | 3300042643 | Bacteria | 2206 |
| 114 | Ga0466716_464939 | 3300042605 | Bacteria | 13234 |
| 115 | Ga0466732_053553 | 3300042656 | Bacteria | 8600 |
| 116 | Ga0264413_103775 | 3300024493 | Bacteria | 1932 |
| 117 | Ga0264413_114202 | 3300024493 | Bacteria | 1416 |
| 118 | Ga0466694_374615 | 3300042594 | Bacteria | 1097 |
| 119 | Ga0466699_274253 | 3300042597 | Bacteria | 1417 |
| 120 | Ga0466712_032990 | 3300042614 | Bacteria | 9735 |
| 121 | Ga0466712_050568 | 3300042614 | Bacteria | 2632 |
| 122 | Ga0466712_119962 | 3300042614 | Bacteria | 8787 |
| 123 | Ga0466712_127851 | 3300042614 | Bacteria | 5260 |
| 124 | Ga0466718_024701 | 3300042617 | Bacteria | 4926 |
| 125 | Ga0466718_034087 | 3300042617 | Bacteria | 1845 |
| 126 | Ga0466718_042183 | 3300042617 | Bacteria | 62729 |
| 127 | Ga0466718_082625 | 3300042617 | Bacteria | 11180 |
| 128 | AustNasuHG_c1000615 | 3300000089 | Bacteria | 12588 |
| 129 | JGI24698J34947_10003336 | 3300002449 | Bacteria | 8713 |
| 130 | JGI24698J34947_10015392 | 3300002449 | Bacteria | 4165 |
| 131 | JGI24698J34947_10044613 | 3300002449 | Bacteria | 2268 |
| 132 | JGI24698J34947_10056174 | 3300002449 | Bacteria | 1958 |
| 133 | JGI24698J34947_10089274 | 3300002449 | Bacteria | 1419 |
| 134 | JGI24698J34947_10276525 | 3300002449 | Bacteria | 615 |
| 135 | JGI24695J34938_10000943 | 3300002450 | Bacteria | 26509 |
| 136 | JGI24695J34938_10003966 | 3300002450 | Bacteria | 9973 |
| 137 | Ga0072941_1022407 | 3300005201 | Bacteria | 4486 |
| 138 | Ga0072941_1097063 | 3300005201 | Bacteria | 2372 |
| 139 | Ga0466720_021301 | 3300042607 | Bacteria | 3514 |
| 140 | Ga0466720_022808 | 3300042607 | Bacteria | 44153 |
| 141 | Ga0466720_029273 | 3300042607 | Bacteria | 6055 |
| 142 | Ga0466720_051624 | 3300042607 | Bacteria | 5154 |
| 143 | Ga0466720_110596 | 3300042607 | Bacteria | 36874 |
| 144 | Ga0466720_153791 | 3300042607 | Bacteria | 1850 |
| 145 | Ga0466720_223463 | 3300042607 | Unclassified | 1241 |
| 146 | Ga0466732_394827 | 3300042656 | Bacteria | 3834 |
| 147 | Ga0123356_10001171 | 3300010049 | Bacteria | 29024 |
| 148 | Ga0123353_10976066 | 3300010167 | Bacteria | 1142 |
| 149 | Ga0466699_267948 | 3300042597 | Bacteria | 1397 |
| 150 | Ga0466712_040576 | 3300042614 | Bacteria | 5337 |
| 151 | Ga0466712_049852 | 3300042614 | Bacteria | 1404 |
| 152 | Ga0466712_061668 | 3300042614 | Bacteria | 8540 |
| 153 | Ga0466712_192239 | 3300042614 | Bacteria | 4755 |
| 154 | Ga0466712_252518 | 3300042614 | Unclassified | 4159 |
| 155 | Ga0466712_252635 | 3300042614 | Bacteria | 4390 |
| 156 | AustNasuHG_c1001726 | 3300000089 | Bacteria | 7899 |
| 157 | JGI24698J34947_10008313 | 3300002449 | Bacteria | 5691 |
| 158 | JGI24698J34947_10011139 | 3300002449 | Bacteria | 4936 |
| 159 | JGI24698J34947_10110374 | 3300002449 | Bacteria | 1216 |
| 160 | JGI24698J34947_10184174 | 3300002449 | Bacteria | 832 |
| 161 | Ga0072941_1010736 | 3300005201 | Bacteria | 42532 |
| 162 | Ga0072941_1019076 | 3300005201 | Bacteria | 8553 |
| 163 | Ga0466700_213243 | 3300042600 | Unclassified | 1231 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF02823 | GO:0015986 | proton motive force-driven ATP synthesis | BP |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.