Protein Family IF01226
Metagenome
Isolate
120
Members
43
Samples
110
Scaffolds
338.45
Avg Length
Representative Sequence
- ID
- 3300005200|Ga0072940_1007484|Ga0072940_10074843
- Length
- 315 aa
- Sequence
- LEKFADEAIIEVSSGSGGNGCAAFRREKYVPRGGPSDVVFTVRRNLRTLAHLRYKFSFRAENGRADVVIPLPPGSLIRDSGNQKNFIFLKGGNGGWGNIHFKSSVNQSPRKALPGKPGQTVRLKVELQIMADIGLVGFPNAGKSSLLDRLTNARPKIAAYPFTTKIPNLGVLTSGERDVIIADIPGLIEGASHGAGLGFYFLKHISRTAALAFLIDLSDDNYLEAFDILLNELKSFSEELAGKNRLIIGTKTDLAETTGRLSELAQKYPAEEVMGISVFSGEGIKELSYAFLRLTENHEESANLNDILNEGDDL*
Sample Types
Isolate
8.3%
Metagenome
91.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
48.8%
Unclassified
24.4%
Kalotermitidae
22.0%
Termopsidae
4.9%
Taxonomy
Archaea
0
Bacteria
116
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125657 | Treponema sp. Emb289P3bin15 | Isolate | Unclassified |
| 2 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 3 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 4 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 5 | 2228664004 | P3 Gut Segment Termite Single Cell Genome_Treponema sp. T3b, from Florida USA | Metagenome | Termitidae |
| 6 | 2781125650 | Treponema sp. Co191P3bin64 | Isolate | Unclassified |
| 7 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 8 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 9 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 10 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 11 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 12 | 2781125647 | Treponema sp. Co191P3bin16 | Isolate | Unclassified |
| 13 | 2781125636 | Treponema sp. Co191P1bin67 | Isolate | Unclassified |
| 14 | 2781125662 | Treponema sp. Emb289P3bin141 | Isolate | Unclassified |
| 15 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 16 | 2781125665 | Treponema sp. Emb289P3bin117 | Isolate | Unclassified |
| 17 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 18 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 19 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 20 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 21 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 22 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 23 | 2781125660 | Treponema sp. Emb289P3bin52 | Isolate | Unclassified |
| 24 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 25 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 26 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 27 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 28 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 29 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 30 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 31 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 32 | 2781125634 | Treponema sp. Co191P1bin45 | Isolate | Unclassified |
| 33 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 34 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 35 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 36 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 37 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 38 | 2781125638 | Treponema sp. Co191P1bin8 | Isolate | Unclassified |
| 39 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 40 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 41 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 42 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 43 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466718_127793 | 3300042617 | Bacteria | 1107 |
| 2 | Ga0466721_220378 | 3300042608 | Bacteria | 49670 |
| 3 | Ga0123356_10018827 | 3300010049 | Bacteria | 6553 |
| 4 | Ga0123356_10048132 | 3300010049 | Bacteria | 3968 |
| 5 | Ga0466702_078035 | 3300042635 | Bacteria | 18489 |
| 6 | Ga0466702_329253 | 3300042635 | Bacteria | 4973 |
| 7 | Ga0466704_002963 | 3300042643 | Bacteria | 15827 |
| 8 | Ga0466727_039521 | 3300042655 | Bacteria | 1569 |
| 9 | AustNasuHG_c1039234 | 3300000089 | Bacteria | 1179 |
| 10 | JGI24698J34947_10003487 | 3300002449 | Bacteria | 8537 |
| 11 | JGI24698J34947_10033365 | 3300002449 | Bacteria | 2702 |
| 12 | JGI24695J34938_10000045 | 3300002450 | Bacteria | 92650 |
| 13 | JGI24695J34938_10000766 | 3300002450 | Bacteria | 30215 |
| 14 | JGI24695J34938_10002280 | 3300002450 | Bacteria | 14811 |
| 15 | Ga0072941_1003306 | 3300005201 | Bacteria | 11827 |
| 16 | Ga0466694_200290 | 3300042594 | Bacteria | 10044 |
| 17 | Ga0466699_140940 | 3300042597 | Bacteria | 18606 |
| 18 | Ga0466719_396391 | 3300042606 | Bacteria | 20129 |
| 19 | Ga0466720_031024 | 3300042607 | Bacteria | 6147 |
| 20 | Ga0466703_213711 | 3300042636 | Bacteria | 33262 |
| 21 | Ga0466703_255570 | 3300042636 | Bacteria | 3368 |
| 22 | Ga0466704_151352 | 3300042643 | Bacteria | 18052 |
| 23 | 2230969641 | 2228664004 | Bacteria | 7204 |
| 24 | AustNasuHG_c1000005 | 3300000089 | Bacteria | 56942 |
| 25 | JGI24695J34938_10009583 | 3300002450 | Bacteria | 5374 |
| 26 | Ga0466712_040231 | 3300042614 | Bacteria | 12213 |
| 27 | Ga0466712_248012 | 3300042614 | Bacteria | 7175 |
| 28 | Ga0466718_033452 | 3300042617 | Bacteria | 16993 |
| 29 | Ga0466723_011294 | 3300042618 | Bacteria | 53611 |
| 30 | Ga0466690_316764 | 3300042590 | Bacteria | 7665 |
| 31 | Ga0466699_255149 | 3300042597 | Bacteria | 3057 |
| 32 | Ga0123356_10084251 | 3300010049 | Bacteria | 3012 |
| 33 | Ga0466702_273378 | 3300042635 | Bacteria | 8664 |
| 34 | Ga0466702_320955 | 3300042635 | Bacteria | 1515 |
| 35 | JGI24695J34938_10001205 | 3300002450 | Bacteria | 22922 |
| 36 | JGI24695J34938_10003864 | 3300002450 | Bacteria | 10144 |
| 37 | JGI24695J34938_10007527 | 3300002450 | Bacteria | 6359 |
| 38 | JGI24695J34938_10021463 | 3300002450 | Bacteria | 3157 |
| 39 | JGI24699J35502_11106304 | 3300002509 | Unclassified | 2521 |
| 40 | Ga0072940_1007484 | 3300005200 | Bacteria | 6182 |
| 41 | Ga0466705_446328 | 3300042612 | Bacteria | 6638 |
| 42 | Ga0466699_274412 | 3300042597 | Bacteria | 7094 |
| 43 | Ga0466699_314935 | 3300042597 | Bacteria | 35477 |
| 44 | Ga0466720_175813 | 3300042607 | Bacteria | 6467 |
| 45 | Ga0466720_201987 | 3300042607 | Bacteria | 5915 |
| 46 | Ga0466721_292592 | 3300042608 | Bacteria | 4555 |
| 47 | Ga0123356_10000240 | 3300010049 | Bacteria | 63107 |
| 48 | Ga0123356_10004193 | 3300010049 | Bacteria | 14942 |
| 49 | Ga0123356_10007299 | 3300010049 | Bacteria | 11032 |
| 50 | Ga0123356_10167891 | 3300010049 | Bacteria | 2201 |
| 51 | Ga0466702_271442 | 3300042635 | Bacteria | 2295 |
| 52 | AustNasuHG_c1002635 | 3300000089 | Bacteria | 6478 |
| 53 | JGI24698J34947_10000080 | 3300002449 | Bacteria | 31361 |
| 54 | JGI24695J34938_10003707 | 3300002450 | Bacteria | 10442 |
| 55 | JGI24695J34938_10005061 | 3300002450 | Bacteria | 8375 |
| 56 | JGI24695J34938_10005687 | 3300002450 | Bacteria | 7694 |
| 57 | Ga0072941_1009212 | 3300005201 | Bacteria | 12195 |
| 58 | Ga0466712_028735 | 3300042614 | Bacteria | 38990 |
| 59 | Ga0466715_006525 | 3300042616 | Bacteria | 2396 |
| 60 | Ga0466718_065755 | 3300042617 | Unclassified | 14643 |
| 61 | Ga0466699_257329 | 3300042597 | Bacteria | 15190 |
| 62 | Ga0466699_420360 | 3300042597 | Bacteria | 1927 |
| 63 | Ga0123356_10000561 | 3300010049 | Bacteria | 41259 |
| 64 | Ga0123356_10468140 | 3300010049 | Bacteria | 1411 |
| 65 | Ga0123353_10566964 | 3300010167 | Bacteria | 1633 |
| 66 | JGI24695J34938_10000133 | 3300002450 | Bacteria | 67517 |
| 67 | JGI24695J34938_10005353 | 3300002450 | Bacteria | 8026 |
| 68 | Ga0072941_1032280 | 3300005201 | Bacteria | 4236 |
| 69 | Ga0466726_086990 | 3300042619 | Bacteria | 22113 |
| 70 | Ga0264413_101471 | 3300024493 | Bacteria | 49537 |
| 71 | Ga0466693_004183 | 3300042592 | Bacteria | 23210 |
| 72 | Ga0466699_276206 | 3300042597 | Bacteria | 9001 |
| 73 | Ga0466699_380842 | 3300042597 | Bacteria | 2215 |
| 74 | Ga0466717_038350 | 3300042604 | Bacteria | 1836 |
| 75 | JGI24695J34938_10005072 | 3300002450 | Bacteria | 8372 |
| 76 | JGI24695J34938_10005648 | 3300002450 | Bacteria | 7730 |
| 77 | Ga0466712_000470 | 3300042614 | Bacteria | 25247 |
| 78 | Ga0466712_099818 | 3300042614 | Bacteria | 14525 |
| 79 | Ga0466712_155179 | 3300042614 | Bacteria | 14401 |
| 80 | Ga0466712_227966 | 3300042614 | Bacteria | 8768 |
| 81 | Ga0466718_034581 | 3300042617 | Bacteria | 1253 |
| 82 | Ga0415639_041956 | 3300038395 | Bacteria | 14603 |
| 83 | Ga0415639_042755 | 3300038395 | Bacteria | 3672 |
| 84 | Ga0415639_145998 | 3300038395 | Bacteria | 3385 |
| 85 | Ga0466693_039798 | 3300042592 | Unclassified | 4058 |
| 86 | Ga0466691_056468 | 3300042593 | Bacteria | 19607 |
| 87 | Ga0466694_066477 | 3300042594 | Bacteria | 2650 |
| 88 | Ga0466699_055698 | 3300042597 | Bacteria | 7941 |
| 89 | Ga0466699_123446 | 3300042597 | Bacteria | 8666 |
| 90 | Ga0466720_171874 | 3300042607 | Unclassified | 1961 |
| 91 | Ga0123356_10000125 | 3300010049 | Bacteria | 84722 |
| 92 | Ga0123356_10012336 | 3300010049 | Bacteria | 8298 |
| 93 | Ga0123356_10020848 | 3300010049 | Bacteria | 6199 |
| 94 | Ga0466702_145974 | 3300042635 | Bacteria | 2061 |
| 95 | Ga0466702_174439 | 3300042635 | Bacteria | 3179 |
| 96 | JGI24698J34947_10000117 | 3300002449 | Bacteria | 28041 |
| 97 | JGI24698J34947_10005898 | 3300002449 | Bacteria | 6714 |
| 98 | Ga0466732_029143 | 3300042656 | Bacteria | 8918 |
| 99 | Ga0466712_084186 | 3300042614 | Bacteria | 8655 |
| 100 | Ga0466718_078288 | 3300042617 | Bacteria | 22152 |
| 101 | Ga0466728_160467 | 3300042620 | Bacteria | 8247 |
| 102 | Ga0264413_105677 | 3300024493 | Bacteria | 11783 |
| 103 | Ga0415639_034121 | 3300038395 | Bacteria | 6028 |
| 104 | Ga0466699_303629 | 3300042597 | Bacteria | 10226 |
| 105 | Ga0123355_10423051 | 3300009826 | Bacteria | 1701 |
| 106 | JGI24698J34947_10000264 | 3300002449 | Bacteria | 22404 |
| 107 | JGI24698J34947_10037754 | 3300002449 | Bacteria | 2508 |
| 108 | JGI24695J34938_10001095 | 3300002450 | Bacteria | 24483 |
| 109 | JGI24695J34938_10002277 | 3300002450 | Bacteria | 14816 |
| 110 | JGI24695J34938_10065867 | 3300002450 | Bacteria | 1528 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF02421 | GO:0005525 | GTP binding | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.