Protein Family IF01192
Metagenome
Isolate
122
Members
42
Samples
117
Scaffolds
499.59
Avg Length
Representative Sequence
- ID
- 3300005083|Ga0068305_10065751|Ga0068305_100657512
- Length
- 582 aa
- Sequence
- MGIGMFGLVVYDAGRKECEMSLMKGFCSKKFFVFNLVLLGAMFGFALSFLSFSCANPGKTGVKAQGFTDTPGSPAAFNVSPPMDALAVAEGLQNAFRFVADKAQPSVVEIKTETVQRRTIPNLDGIPWEFFFGPRDRSDSTPRSKEREFRSQGLGSGIIVRQKNGAYYALTNNHVVDGVDKDKIIVVSSAGKEYQAELVGQDDRKDLAMISFRTKDEFPLAELGDSDAVRAGDWAIAVGSPLGFMSSVTMGIVSAVGRTGGPGGNINDFIQTDAAINQGNSGGALVNIMGEVIGINTWIASNNGGSSIGLGFAIPINNAKRSIDDFIDKGKTSYGWLGVSLIDADKDLAQALGLEGKRGALTVNAFLGSPGDKGGIRAGDFITHVNGREARDRNQVTLMVGDLKPGEKAEFTVIRDGVEQKFRVTIDPRDDKVASDYKKLWPGVIVAPVTGSLRKVLELGDSAEGLAAVQVEAGSPAAVVGLQRGDIITAINETPVKDAAAFYKALREKTSKELWFGFVRGGTELESLKYKRXPIGKRAQPVLRRYGARLVKNRQRPVTAKSAFHFLQSTFSPCRGPGRPV*
Sample Types
Isolate
4.1%
Metagenome
95.9%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
34.1%
Termitidae
31.7%
Unclassified
19.5%
Rhinotermitidae
7.3%
Termopsidae
7.3%
Taxonomy
Archaea
0
Bacteria
118
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 2 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 3 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 4 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 5 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 6 | 2781125691 | Treponema sp. Th196P3bin73 | Isolate | Unclassified |
| 7 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 8 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 9 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 10 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 11 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 12 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 13 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 14 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 15 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 16 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 17 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 18 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 19 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 20 | 2781125660 | Treponema sp. Emb289P3bin52 | Isolate | Unclassified |
| 21 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 22 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 23 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 24 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 25 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 26 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 27 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 28 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 29 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 30 | 2781125649 | Treponema sp. Co191P3bin15 | Isolate | Unclassified |
| 31 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 32 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 33 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 34 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 35 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 36 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 37 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 38 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 39 | 2781125637 | Treponema sp. Co191P1bin9 | Isolate | Unclassified |
| 40 | 2819994798 | Unclassified Spirochaetes Th196P1bin3 | Isolate | Unclassified |
| 41 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 42 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466713_026171 | 3300042602 | Bacteria | 44886 |
| 2 | Ga0466716_031431 | 3300042605 | Bacteria | 13180 |
| 3 | Ga0466719_205580 | 3300042606 | Bacteria | 17203 |
| 4 | Ga0466719_273074 | 3300042606 | Bacteria | 8121 |
| 5 | Ga0123356_10036988 | 3300010049 | Bacteria | 4556 |
| 6 | JGI24698J34947_10022424 | 3300002449 | Bacteria | 3386 |
| 7 | Ga0466704_517718 | 3300042643 | Unclassified | 2631 |
| 8 | Ga0466708_139336 | 3300042652 | Bacteria | 48639 |
| 9 | Ga0466692_001030 | 3300042591 | Bacteria | 7363 |
| 10 | Ga0466718_084863 | 3300042617 | Bacteria | 20109 |
| 11 | Ga0466726_121611 | 3300042619 | Bacteria | 11809 |
| 12 | Ga0466707_014831 | 3300042601 | Bacteria | 2390 |
| 13 | Ga0466713_067507 | 3300042602 | Unclassified | 2145 |
| 14 | Ga0466720_179737 | 3300042607 | Bacteria | 2787 |
| 15 | JGI24695J34938_10003114 | 3300002450 | Bacteria | 11840 |
| 16 | Ga0068305_10043151 | 3300005083 | Bacteria | 8060 |
| 17 | Ga0466704_093405 | 3300042643 | Unclassified | 3370 |
| 18 | Ga0466704_494829 | 3300042643 | Bacteria | 21929 |
| 19 | Ga0466727_050276 | 3300042655 | Bacteria | 17589 |
| 20 | Ga0466727_277270 | 3300042655 | Bacteria | 4420 |
| 21 | Ga0466696_294403 | 3300042596 | Bacteria | 3659 |
| 22 | Ga0466711_143524 | 3300042615 | Bacteria | 1828 |
| 23 | Ga0466718_024305 | 3300042617 | Bacteria | 24673 |
| 24 | Ga0466723_163120 | 3300042618 | Bacteria | 30495 |
| 25 | Ga0466726_058122 | 3300042619 | Bacteria | 1975 |
| 26 | JGI24695J34938_10000313 | 3300002450 | Bacteria | 47889 |
| 27 | Ga0466702_083541 | 3300042635 | Bacteria | 6942 |
| 28 | Ga0466703_101322 | 3300042636 | Bacteria | 2836 |
| 29 | Ga0466709_304850 | 3300042648 | Bacteria | 2538 |
| 30 | Ga0466709_395836 | 3300042648 | Bacteria | 9788 |
| 31 | Ga0466727_063908 | 3300042655 | Bacteria | 9048 |
| 32 | Ga0415639_015890 | 3300038395 | Bacteria | 14320 |
| 33 | Ga0466691_017068 | 3300042593 | Bacteria | 13968 |
| 34 | Ga0466691_113509 | 3300042593 | Bacteria | 1860 |
| 35 | Ga0466694_056800 | 3300042594 | Bacteria | 9597 |
| 36 | Ga0466696_149941 | 3300042596 | Bacteria | 7935 |
| 37 | Ga0466699_004930 | 3300042597 | Bacteria | 3023 |
| 38 | Ga0466712_214749 | 3300042614 | Unclassified | 2462 |
| 39 | Ga0466715_424072 | 3300042616 | Bacteria | 2845 |
| 40 | Ga0466723_064755 | 3300042618 | Bacteria | 6940 |
| 41 | Ga0466728_000324 | 3300042620 | Bacteria | 13884 |
| 42 | Ga0466705_048053 | 3300042612 | Bacteria | 8422 |
| 43 | Ga0466719_548975 | 3300042606 | Bacteria | 13562 |
| 44 | Ga0123356_10000125 | 3300010049 | Bacteria | 84722 |
| 45 | Ga0466735_013676 | 3300042624 | Bacteria | 7918 |
| 46 | Ga0466703_307847 | 3300042636 | Bacteria | 10141 |
| 47 | Ga0466704_072607 | 3300042643 | Bacteria | 5997 |
| 48 | Ga0466708_033753 | 3300042652 | Bacteria | 12237 |
| 49 | Ga0456237_0001925 | 3300041968 | Bacteria | 3348 |
| 50 | Ga0466692_118198 | 3300042591 | Bacteria | 4855 |
| 51 | Ga0466691_118944 | 3300042593 | Bacteria | 3566 |
| 52 | Ga0466711_195788 | 3300042615 | Bacteria | 43179 |
| 53 | Ga0466715_016086 | 3300042616 | Bacteria | 18465 |
| 54 | Ga0466715_067483 | 3300042616 | Bacteria | 42347 |
| 55 | Ga0466723_077836 | 3300042618 | Bacteria | 6912 |
| 56 | Ga0466723_322133 | 3300042618 | Bacteria | 5773 |
| 57 | Ga0466705_279687 | 3300042612 | Bacteria | 10621 |
| 58 | Ga0466719_375641 | 3300042606 | Bacteria | 9026 |
| 59 | JGI24698J34947_10001592 | 3300002449 | Bacteria | 12046 |
| 60 | JGI24695J34938_10003990 | 3300002450 | Bacteria | 9944 |
| 61 | JGI24696J40584_12941566 | 3300002834 | Bacteria | 1713 |
| 62 | Ga0072941_1002310 | 3300005201 | Bacteria | 31707 |
| 63 | Ga0466709_294029 | 3300042648 | Bacteria | 18142 |
| 64 | Ga0466690_020265 | 3300042590 | Bacteria | 3866 |
| 65 | Ga0466699_165217 | 3300042597 | Bacteria | 13505 |
| 66 | Ga0466705_445603 | 3300042612 | Bacteria | 24455 |
| 67 | Ga0466718_091517 | 3300042617 | Bacteria | 3704 |
| 68 | Ga0466705_294116 | 3300042612 | Bacteria | 3903 |
| 69 | Ga0466720_044223 | 3300042607 | Bacteria | 4336 |
| 70 | Ga0466720_045337 | 3300042607 | Bacteria | 10655 |
| 71 | JGI24695J34938_10002770 | 3300002450 | Bacteria | 12863 |
| 72 | Ga0466703_275112 | 3300042636 | Bacteria | 21637 |
| 73 | Ga0466704_168324 | 3300042643 | Bacteria | 6315 |
| 74 | Ga0466704_346596 | 3300042643 | Bacteria | 27825 |
| 75 | Ga0466709_100222 | 3300042648 | Bacteria | 20265 |
| 76 | Ga0466709_145958 | 3300042648 | Bacteria | 4870 |
| 77 | Ga0466727_200548 | 3300042655 | Bacteria | 1901 |
| 78 | Ga0466691_147803 | 3300042593 | Bacteria | 6598 |
| 79 | Ga0466696_052798 | 3300042596 | Bacteria | 9290 |
| 80 | Ga0466699_420355 | 3300042597 | Bacteria | 7481 |
| 81 | Ga0466712_026582 | 3300042614 | Bacteria | 12812 |
| 82 | Ga0466715_080210 | 3300042616 | Bacteria | 95686 |
| 83 | Ga0466715_295665 | 3300042616 | Bacteria | 6186 |
| 84 | Ga0466723_080715 | 3300042618 | Bacteria | 10553 |
| 85 | Ga0466723_287200 | 3300042618 | Bacteria | 2076 |
| 86 | Ga0466705_357238 | 3300042612 | Bacteria | 4510 |
| 87 | Ga0466719_118876 | 3300042606 | Bacteria | 22691 |
| 88 | Ga0466720_142832 | 3300042607 | Bacteria | 4367 |
| 89 | Ga0466722_173966 | 3300042609 | Bacteria | 2769 |
| 90 | Ga0072941_1083459 | 3300005201 | Bacteria | 5085 |
| 91 | Ga0466735_036339 | 3300042624 | Bacteria | 7771 |
| 92 | Ga0466709_109010 | 3300042648 | Bacteria | 2268 |
| 93 | Ga0466690_095730 | 3300042590 | Bacteria | 3322 |
| 94 | Ga0466691_215713 | 3300042593 | Bacteria | 14019 |
| 95 | Ga0466694_092760 | 3300042594 | Bacteria | 30658 |
| 96 | Ga0466696_479402 | 3300042596 | Bacteria | 6960 |
| 97 | Ga0466699_425438 | 3300042597 | Bacteria | 11460 |
| 98 | Ga0466715_016493 | 3300042616 | Bacteria | 28311 |
| 99 | Ga0466715_171069 | 3300042616 | Bacteria | 5846 |
| 100 | Ga0466715_407725 | 3300042616 | Bacteria | 9726 |
| 101 | Ga0466705_049904 | 3300042612 | Bacteria | 3429 |
| 102 | Ga0466733_002260 | 3300042659 | Bacteria | 72130 |
| 103 | Ga0466733_106930 | 3300042659 | Bacteria | 27546 |
| 104 | Ga0466716_321800 | 3300042605 | Bacteria | 2155 |
| 105 | Ga0466719_251791 | 3300042606 | Bacteria | 13678 |
| 106 | Ga0466719_279512 | 3300042606 | Bacteria | 4653 |
| 107 | Ga0466720_040398 | 3300042607 | Bacteria | 4140 |
| 108 | Ga0068305_10065751 | 3300005083 | Bacteria | 2166 |
| 109 | Ga0466731_219877 | 3300042622 | Bacteria | 7389 |
| 110 | Ga0466690_068194 | 3300042590 | Bacteria | 7143 |
| 111 | Ga0466692_160664 | 3300042591 | Bacteria | 21315 |
| 112 | Ga0466691_016219 | 3300042593 | Bacteria | 4957 |
| 113 | Ga0466691_155711 | 3300042593 | Bacteria | 3897 |
| 114 | Ga0466705_428591 | 3300042612 | Bacteria | 2054 |
| 115 | Ga0466711_260505 | 3300042615 | Bacteria | 24653 |
| 116 | Ga0466715_055604 | 3300042616 | Bacteria | 10700 |
| 117 | Ga0466715_305187 | 3300042616 | Bacteria | 8379 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF13180 | GO:0005515 | protein binding | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.