Protein Family IF01181
Metagenome
114
Members
31
Samples
114
Scaffolds
178.14
Avg Length
Representative Sequence
- ID
- 3300005083|Ga0068305_10016636|Ga0068305_1001663612
- Length
- 201 aa
- Sequence
- MDKLDAGAFWNPQVYGGLRQDAKKTGGKRSERAAEKTESRQVGVLRFEEVLKTARPGYLSELGAPRELSPSEEAVRQLLDEVHSAGDSLRQRPFKEEVLAYKKAVRDFLHYVVENSYTTEDHQGVPWGQKPGFSGPLWGEKARMRNKFQAVKVVDAKLEQLAGGILSGQTAQLELLSKLEEITGLLVNLVIAGGLEVNQQ*
Sample Types
Isolate
0.0%
Metagenome
100.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
45.2%
Termitidae
25.8%
Rhinotermitidae
9.7%
Termopsidae
9.7%
Unclassified
9.7%
Taxonomy
Archaea
0
Bacteria
112
Eukaryota
0
Viruses
0
Unclassified
2
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 2 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 3 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 4 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 5 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 6 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 7 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 8 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 9 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 10 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 11 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 12 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 13 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 14 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 15 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 16 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 17 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 18 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 19 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 20 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 21 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 22 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 23 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 24 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 25 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 26 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 27 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 28 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 29 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 30 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 31 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_068047 | 3300042612 | Bacteria | 14016 |
| 2 | Ga0466733_064448 | 3300042659 | Bacteria | 6641 |
| 3 | Ga0456237_0000772 | 3300041968 | Bacteria | 4963 |
| 4 | Ga0466691_100643 | 3300042593 | Bacteria | 3573 |
| 5 | Ga0466699_124950 | 3300042597 | Bacteria | 1237 |
| 6 | Ga0466711_433569 | 3300042615 | Bacteria | 11190 |
| 7 | Ga0466715_434660 | 3300042616 | Bacteria | 16377 |
| 8 | Ga0466726_440480 | 3300042619 | Bacteria | 1196 |
| 9 | Ga0466716_062306 | 3300042605 | Bacteria | 8123 |
| 10 | Ga0466722_196199 | 3300042609 | Bacteria | 2146 |
| 11 | Ga0466703_406221 | 3300042636 | Bacteria | 7167 |
| 12 | Ga0466704_000981 | 3300042643 | Bacteria | 3023 |
| 13 | Ga0466709_032902 | 3300042648 | Bacteria | 4210 |
| 14 | Ga0466708_291727 | 3300042652 | Bacteria | 3039 |
| 15 | Ga0466708_417217 | 3300042652 | Bacteria | 1494 |
| 16 | Ga0068305_10027244 | 3300005083 | Bacteria | 4502 |
| 17 | Ga0466733_051499 | 3300042659 | Bacteria | 21579 |
| 18 | Ga0466733_077600 | 3300042659 | Bacteria | 18102 |
| 19 | Ga0466733_144563 | 3300042659 | Bacteria | 6115 |
| 20 | Ga0466690_033183 | 3300042590 | Bacteria | 8135 |
| 21 | Ga0466692_201863 | 3300042591 | Bacteria | 5519 |
| 22 | Ga0466699_354758 | 3300042597 | Bacteria | 1277 |
| 23 | Ga0466723_324233 | 3300042618 | Bacteria | 2002 |
| 24 | Ga0466713_026978 | 3300042602 | Bacteria | 4992 |
| 25 | Ga0466722_003188 | 3300042609 | Bacteria | 10502 |
| 26 | Ga0466722_243899 | 3300042609 | Bacteria | 8865 |
| 27 | Ga0466703_132198 | 3300042636 | Bacteria | 7811 |
| 28 | Ga0466727_075769 | 3300042655 | Bacteria | 2788 |
| 29 | Ga0466727_299156 | 3300042655 | Bacteria | 5104 |
| 30 | JGI24698J34947_10001100 | 3300002449 | Bacteria | 13934 |
| 31 | Ga0466705_107715 | 3300042612 | Bacteria | 4752 |
| 32 | Ga0456237_0006097 | 3300041968 | Bacteria | 1898 |
| 33 | Ga0466692_193468 | 3300042591 | Bacteria | 6527 |
| 34 | Ga0466699_204864 | 3300042597 | Bacteria | 23287 |
| 35 | Ga0466712_007651 | 3300042614 | Bacteria | 1156 |
| 36 | Ga0466713_068790 | 3300042602 | Bacteria | 7054 |
| 37 | Ga0466722_071361 | 3300042609 | Bacteria | 6858 |
| 38 | Ga0466703_059458 | 3300042636 | Bacteria | 2930 |
| 39 | Ga0466704_004348 | 3300042643 | Bacteria | 5019 |
| 40 | Ga0466704_097928 | 3300042643 | Bacteria | 8861 |
| 41 | Ga0466704_393458 | 3300042643 | Bacteria | 46073 |
| 42 | Ga0466709_227983 | 3300042648 | Bacteria | 10490 |
| 43 | Ga0466708_028482 | 3300042652 | Bacteria | 2403 |
| 44 | Ga0466708_191069 | 3300042652 | Bacteria | 4565 |
| 45 | Ga0466708_318222 | 3300042652 | Bacteria | 3481 |
| 46 | Ga0456237_0007625 | 3300041968 | Bacteria | 1660 |
| 47 | Ga0466726_175157 | 3300042619 | Bacteria | 2494 |
| 48 | Ga0466726_240687 | 3300042619 | Bacteria | 6023 |
| 49 | Ga0466716_408809 | 3300042605 | Bacteria | 2520 |
| 50 | Ga0466719_047566 | 3300042606 | Bacteria | 14696 |
| 51 | Ga0466703_413621 | 3300042636 | Bacteria | 8368 |
| 52 | Ga0466709_108060 | 3300042648 | Bacteria | 10082 |
| 53 | Ga0466727_334405 | 3300042655 | Bacteria | 6700 |
| 54 | Ga0466733_077129 | 3300042659 | Bacteria | 2768 |
| 55 | Ga0466690_237721 | 3300042590 | Bacteria | 2002 |
| 56 | Ga0466691_012102 | 3300042593 | Bacteria | 5902 |
| 57 | Ga0466715_271080 | 3300042616 | Bacteria | 2317 |
| 58 | Ga0466723_006858 | 3300042618 | Bacteria | 10903 |
| 59 | Ga0466723_343199 | 3300042618 | Bacteria | 1399 |
| 60 | Ga0466726_091480 | 3300042619 | Bacteria | 17295 |
| 61 | Ga0466726_329867 | 3300042619 | Bacteria | 2210 |
| 62 | Ga0466728_044460 | 3300042620 | Bacteria | 8869 |
| 63 | Ga0466707_377403 | 3300042601 | Bacteria | 1709 |
| 64 | Ga0466704_399163 | 3300042643 | Unclassified | 3785 |
| 65 | Ga0466709_120503 | 3300042648 | Bacteria | 5088 |
| 66 | Ga0466709_418304 | 3300042648 | Bacteria | 3267 |
| 67 | Ga0466727_054365 | 3300042655 | Bacteria | 1465 |
| 68 | Ga0123353_10867467 | 3300010167 | Bacteria | 1234 |
| 69 | Ga0466705_003026 | 3300042612 | Bacteria | 4367 |
| 70 | Ga0466705_026767 | 3300042612 | Bacteria | 8764 |
| 71 | Ga0466733_058812 | 3300042659 | Bacteria | 5995 |
| 72 | Ga0466733_075593 | 3300042659 | Bacteria | 4724 |
| 73 | Ga0466692_048447 | 3300042591 | Bacteria | 5978 |
| 74 | Ga0466691_161384 | 3300042593 | Unclassified | 3788 |
| 75 | Ga0466696_026657 | 3300042596 | Bacteria | 1472 |
| 76 | Ga0466696_214759 | 3300042596 | Bacteria | 5954 |
| 77 | Ga0466699_137635 | 3300042597 | Bacteria | 2638 |
| 78 | Ga0466699_193181 | 3300042597 | Bacteria | 1860 |
| 79 | Ga0466699_442227 | 3300042597 | Bacteria | 2661 |
| 80 | Ga0466715_003901 | 3300042616 | Bacteria | 26867 |
| 81 | Ga0466715_043153 | 3300042616 | Bacteria | 3433 |
| 82 | Ga0466715_449858 | 3300042616 | Bacteria | 18416 |
| 83 | Ga0466700_318468 | 3300042600 | Bacteria | 1175 |
| 84 | Ga0466707_369339 | 3300042601 | Bacteria | 1063 |
| 85 | Ga0466713_128692 | 3300042602 | Bacteria | 19626 |
| 86 | Ga0466719_558384 | 3300042606 | Bacteria | 2940 |
| 87 | Ga0466698_270384 | 3300042610 | Bacteria | 1058 |
| 88 | Ga0466703_125254 | 3300042636 | Bacteria | 5350 |
| 89 | Ga0068305_10016636 | 3300005083 | Bacteria | 20797 |
| 90 | Ga0123356_11838668 | 3300010049 | Bacteria | 753 |
| 91 | Ga0466705_113672 | 3300042612 | Bacteria | 11968 |
| 92 | Ga0456237_0000557 | 3300041968 | Bacteria | 5679 |
| 93 | Ga0466692_204240 | 3300042591 | Bacteria | 36789 |
| 94 | Ga0466691_043492 | 3300042593 | Bacteria | 6062 |
| 95 | Ga0466711_109103 | 3300042615 | Bacteria | 16915 |
| 96 | Ga0466728_234808 | 3300042620 | Bacteria | 2477 |
| 97 | Ga0466707_295995 | 3300042601 | Bacteria | 1512 |
| 98 | Ga0466719_311189 | 3300042606 | Bacteria | 2603 |
| 99 | Ga0466735_040630 | 3300042624 | Bacteria | 3226 |
| 100 | Ga0466735_059695 | 3300042624 | Bacteria | 1654 |
| 101 | Ga0466703_078759 | 3300042636 | Bacteria | 8576 |
| 102 | Ga0466704_447311 | 3300042643 | Bacteria | 3572 |
| 103 | JGI24698J34947_10003808 | 3300002449 | Bacteria | 8219 |
| 104 | JGI24698J34947_10272926 | 3300002449 | Bacteria | 621 |
| 105 | Ga0466692_092393 | 3300042591 | Bacteria | 1587 |
| 106 | Ga0466699_354880 | 3300042597 | Bacteria | 2342 |
| 107 | Ga0466715_311985 | 3300042616 | Bacteria | 1213 |
| 108 | Ga0466726_190697 | 3300042619 | Bacteria | 1607 |
| 109 | Ga0466726_283175 | 3300042619 | Bacteria | 1486 |
| 110 | Ga0466728_053105 | 3300042620 | Bacteria | 22958 |
| 111 | Ga0466719_026997 | 3300042606 | Bacteria | 1133 |
| 112 | Ga0466703_087424 | 3300042636 | Bacteria | 9589 |
| 113 | Ga0466704_172270 | 3300042643 | Bacteria | 12794 |
| 114 | Ga0466704_428013 | 3300042643 | Bacteria | 23996 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF03885 | DUF327 | Protein of unknown function (DUF327) | 145 | 190 | 0.92 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.